Details for Kale Locus Bo5g128860

Position : C5 ( 5`- 39876126 .. 39878041 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g128860

Protein [Map View]
MMSVERSFEAWEEVQRQGLDLADRLAQGFTGLIQINPPSFPWPHHHQKSKPFDLEFPIQHFDAIRDYSFGIINQPINGVA
AVLDVGSKIGQAGVDFGSGLNLMVQQFFRRLPVPFMQDDIKLSGKSIRSHRAYVDTKDDLGLAAERLKDSGFSKKDDSVT
MSEEEVADSYLRTGGFLGRSKGKIDMSSSYDSRTNGMEHSLAARGDIWRLEASSSSSTASDGTSSLFLLQLGPILFLRDS
TLLLPLHLSKQHLLWYGYDRKKGMHSLCPAVWSKHRRWLMMSMLCLNPLSCSFMDLQFPNGQLTYVSGEGLTVSTFVPFC
GGLLQAQGQYPGDMRFSYSCKNKHGTRITPMVHLPDKSFALEVSQGLAWRRSGLLMKPTLQLSVCPTFGGSNPGMKAEVI
HSLRDDLNLIYGYALTAHPSAFASVSFGRSKWNGNNGRTGIVVRADTPLAASIGQPSFSVQLNNSFEF*

DNA
ATGATGTCGGTGGAGAGATCTTTCGAAGCTTGGGAAGAGGTTCAACGACAAGGGCTAGATTTAGCGGATCGGCTCGCTCA
GGGCTTCACGGGTTTGATTCAGATTAACCCACCTTCCTTCCCATGGCCTCATCATCATCAAAAGTCGAAACCTTTCGATC
TCGAGTTCCCGATTCAACATTTCGACGCTATTAGAGATTATAGCTTCGGTATTATTAACCAACCCATCAACGGCGTTGCG
GCGGTTCTCGATGTTGGGAGTAAGATAGGTCAAGCTGGTGTTGATTTCGGTTCTGGATTGAACCTCATGGTCCAGCAGTT
CTTCAGGAGGTTGCCTGTTCCGTTTATGCAAGACGATATCAAGCTTAGTGGTAAGAGTATAAGGAGCCATAGGGCTTATG
TGGATACAAAAGATGATTTGGGATTAGCTGCAGAACGGTTGAAAGACTCAGGTTTTTCTAAGAAAGATGATTCTGTTACT
ATGTCTGAGGAGGAAGTTGCAGATTCTTACTTGAGAACAGGTGGTTTCCTTGGAAGATCAAAGGGAAAGATTGATATGTC
ATCAAGTTATGATAGTAGAACAAACGGTATGGAACATTCATTGGCAGCCAGGGGAGACATATGGAGACTTGAAGCCTCGA
GTTCGAGTTCTACTGCAAGTGATGGAACTTCGTCTCTCTTTCTTCTCCAGCTTGGACCGATTCTTTTCCTACGCGATTCG
ACTCTTCTTTTACCGTTACACTTATCAAAACAACACTTGCTCTGGTATGGATATGACAGGAAGAAAGGTATGCATTCACT
TTGCCCAGCGGTATGGTCAAAGCATAGAAGATGGCTTATGATGTCAATGCTATGTCTCAACCCTTTATCTTGCTCTTTTA
TGGATTTGCAGTTCCCAAACGGGCAACTGACTTATGTATCCGGCGAGGGGTTGACAGTGAGTACCTTTGTGCCTTTCTGT
GGAGGTCTTCTTCAAGCACAGGGTCAGTATCCAGGCGATATGAGGTTTAGTTACTCTTGTAAGAACAAACATGGAACTAG
AATCACACCAATGGTGCATTTGCCTGACAAATCATTCGCGTTGGAAGTTTCTCAAGGCTTGGCATGGCGTAGATCCGGAC
TACTAATGAAGCCTACACTTCAACTCAGTGTATGTCCCACGTTTGGTGGAAGCAACCCTGGGATGAAAGCGGAAGTGATA
CACTCGCTGAGGGATGACTTGAACTTGATATATGGCTACGCACTCACCGCACATCCTTCGGCATTTGCCTCTGTATCTTT
TGGTCGGTCGAAATGGAATGGCAACAACGGACGCACAGGGATAGTTGTTAGAGCTGATACTCCTCTTGCAGCAAGTATTG
GCCAGCCTTCTTTCTCTGTCCAGCTTAATAACTCTTTTGAGTTCTGA