Details for Kale Locus Bo5g127660

Position : C5 ( 5`- 39680808 .. 39682106 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127660

Protein [Map View]
METVKPLDVASGKGKLRRAFVKVINVKKLTGVVPEGDKDLVKNAANLSESFDKLEEEYEKRLAMEALLAKLFATVSSIKS
GYAQLQYAQSPYDPAGIQRADGLVVSELKTLSEMKQSFLKKEFDSNPDRTLVVAEIQELRSLLKTYEITGKKMECQLKLK
DSEILFLKEKLQELMSQNKLMEKRLNQSVTLDHNSQTHFVTYLHHTVKSIRGFVKTMVQQMRFSGWDVDTAADAIQPGVL
YHKRDHACFAFEHFVCKVMFEAFHLPYFSTESSSSKSRDMFFERFTELRSVKAREYIASRPKSRFSRFCRGKYLQLVHPK
MEVAFFGHSHVRNQVSAGEFPDTSFCAAFLEMAKRVWLLHCLAFSLEPEASIFGVSEGCRFSEVYMKSVSEECLSESEPR
VAFTVVPGFRIGKTSIQCEVYLSPSKSTPDSG*

DNA
ATGGAGACTGTGAAGCCACTGGATGTTGCTTCAGGAAAAGGAAAACTCAGACGCGCGTTTGTGAAAGTCATCAACGTTAA
AAAGCTAACCGGTGTGGTTCCAGAAGGTGACAAAGACTTGGTGAAGAATGCTGCAAATCTTTCAGAGTCATTCGACAAAC
TCGAGGAAGAGTATGAGAAAAGACTCGCCATGGAAGCTCTTCTCGCAAAGCTCTTCGCCACGGTCTCTTCGATTAAATCT
GGCTACGCGCAGCTGCAGTACGCTCAGTCACCGTACGATCCGGCTGGGATTCAGAGAGCAGACGGCTTGGTCGTGTCGGA
GCTGAAGACATTGTCTGAGATGAAACAGAGTTTCTTGAAGAAGGAGTTTGATAGTAACCCCGATAGAACTCTTGTCGTCG
CGGAGATTCAAGAGCTGAGAAGCTTGTTGAAGACGTACGAGATCACGGGGAAGAAGATGGAGTGTCAGTTAAAGCTTAAA
GACTCTGAGATACTCTTCCTCAAAGAGAAGCTTCAAGAATTAATGAGTCAGAACAAGCTGATGGAGAAGAGACTTAACCA
AAGCGTTACACTGGATCATAATAGTCAAACTCATTTCGTTACTTATCTGCACCACACAGTCAAATCAATCCGAGGATTCG
TCAAAACAATGGTTCAGCAAATGAGATTCTCCGGCTGGGACGTGGATACAGCAGCTGATGCGATACAGCCTGGAGTGTTG
TACCACAAGCGAGACCACGCTTGTTTCGCCTTCGAGCATTTCGTTTGTAAAGTAATGTTCGAAGCGTTTCATCTTCCTTA
CTTCTCGACCGAATCATCATCGAGTAAGAGCAGAGATATGTTCTTTGAGAGGTTTACGGAGCTTAGATCGGTGAAGGCGA
GAGAGTACATAGCGTCAAGGCCCAAGTCGAGATTCTCGAGGTTCTGCAGGGGTAAGTATTTGCAGCTCGTGCATCCGAAG
ATGGAGGTCGCGTTCTTCGGACATTCGCACGTGAGGAACCAAGTCTCCGCCGGGGAGTTTCCCGACACGAGTTTCTGCGC
TGCGTTTTTGGAGATGGCGAAACGGGTTTGGCTCTTGCATTGCCTCGCGTTCTCTTTGGAGCCCGAAGCTTCGATCTTTG
GAGTTTCCGAGGGTTGTAGATTCTCGGAAGTGTACATGAAGAGCGTGTCGGAAGAATGCTTGTCGGAATCTGAGCCGAGA
GTTGCGTTTACTGTGGTTCCTGGGTTTAGAATCGGGAAGACTTCGATACAATGCGAGGTTTACCTTTCTCCTTCGAAGTC
AACGCCGGACAGTGGATAG