Details for Kale Locus Bo5g127650

Position : C5 ( 5`- 39676926 .. 39678110 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127650

Protein [Map View]
MSRETAIESFKKFQHTWVEQLQHHLNHLRSVQNHHRNSATGDEERLREAVERVMELCREYHRAKLATTEKDVVGLMAAPW
SSALERSLHWVGDWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSPSQFRFKFVKGRTVSELQCETVKEENAIT
EDLSEWQDDASELVMGTVSNLDQRIRRLAEIVHRADDLRLRTITGVVELLSPLQQAEFLIAAAELRRGVSGWGSSHDRRR
SANV*

DNA
ATGAGCCGAGAGACAGCTATAGAGAGCTTCAAGAAATTTCAACACACATGGGTAGAGCAGCTACAACACCACCTGAACCA
CCTGCGCTCCGTTCAAAACCACCACCGTAACTCTGCTACCGGTGACGAGGAACGGCTGAGAGAAGCGGTGGAGAGAGTGA
TGGAACTTTGTAGAGAGTACCACAGGGCGAAGTTGGCCACGACGGAGAAAGATGTGGTCGGACTTATGGCTGCTCCTTGG
TCTTCGGCTCTTGAACGGTCACTCCATTGGGTTGGTGATTGGCGACCAACGACCTTGTTTCATCTGGTTTACACCGAGTC
TAGTATTTTGTTTGAGTCTCGTATCGTTGATATTCTCCGGGGGTTTCGTACCGGTGATCTCAGTGATCTATCTCCTTCTC
AATTCAGGTTTAAATTTGTCAAAGGCAGGACGGTGAGTGAGCTACAATGTGAGACGGTAAAGGAAGAGAATGCGATAACG
GAAGACTTATCAGAGTGGCAAGACGACGCGAGCGAGCTGGTTATGGGAACGGTGTCCAATCTTGACCAGAGGATACGACG
GCTAGCAGAGATCGTTCATCGAGCCGATGATCTACGACTGAGAACGATCACAGGTGTGGTGGAGCTCCTAAGTCCGCTGC
AACAAGCCGAGTTTCTCATTGCTGCGGCTGAGCTTCGTAGGGGGGTTTCTGGTTGGGGGAGTAGCCATGACCGTCGTCGA
AGTGCCAACGTCTAA