Details for Kale Locus Bo5g127620

Position : C5 ( 5`- 39664746 .. 39666563 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127620

Protein [Map View]
MLGQDLSFSKTLNPRFSFSPFSLRKSPPNSFARRTISVLPVTERNFTFGVKSSELYGGFRRDVRALAGRSKKKPGGSSGG
RIEGDSDTRKQAKRNAREKSKKLAESLFYRLYNNPDKSRSNILSSHPDKFTEDELEMIGLGYDRMVRFMDKDDPRLRHPH
DWFKYGEFGPYSWRGVVVGDPVRGTISDECVTMYGEVANHEEFEKVEQHEMNLAFQKRVKELDSGVGLRYFWVFVRHPKW
RLSELPWEQWTLVSEVVVEADKKKRLDKWNLMGRLGNKSRSLICQCAAWFRPDIVYVKKPVFQCRFEPQEDFFNSIVPYL
NPVTEAGFVFEVEDDDGGVELSTYYGGLCKMLKVRQTAFVDDVVKAYEKCSDEKKSKVLRFLLGNHPIELLHPYTKEWKA
KLEEMELGCDAPDEDEDEVINSGSSEKAEFSEWVEDEGGDSEMEEEEEEDDDDDNMVVDVEGNVEEDSLEGEVDEVDQEE
DERYWEEQFKKATSNAERMEKLAEMSMVVSDQFYEKQLKAMAEREDGDGDLGGDELEMRGKKAKVKPEEWKTVGYGRWMK
KIKKSRIPPELFLRAAVRPFVYRNLVKEIVLTRHAILEGEIGQNE*

DNA
ATGTTAGGCCAAGACTTATCCTTTTCTAAAACCCTAAACCCTAGGTTCTCCTTCTCCCCTTTCTCCCTCCGCAAATCTCC
ACCCAACTCCTTCGCACGAAGGACCATATCCGTTTTACCAGTCACCGAGAGGAATTTTACTTTCGGAGTCAAAAGCTCCG
AGCTTTATGGTGGCTTCCGGCGAGACGTCCGCGCATTGGCGGGTCGGAGCAAGAAGAAACCCGGAGGCTCATCCGGCGGG
AGGATAGAAGGAGACTCCGACACGAGGAAGCAGGCGAAGCGCAACGCCCGCGAGAAGTCCAAGAAGCTAGCGGAGTCTCT
GTTCTACCGCCTCTACAACAACCCCGACAAGTCCCGAAGCAACATCCTCAGCAGCCACCCGGACAAGTTCACTGAAGACG
AGCTCGAGATGATCGGGCTCGGCTACGACAGGATGGTCCGGTTCATGGACAAGGACGACCCGAGGCTGCGCCACCCTCAC
GACTGGTTCAAGTACGGTGAGTTCGGGCCTTACTCGTGGCGCGGCGTCGTGGTCGGGGACCCCGTCCGCGGGACGATCTC
CGACGAGTGCGTGACCATGTACGGGGAAGTGGCGAATCACGAGGAGTTTGAGAAGGTTGAGCAGCACGAGATGAACCTAG
CGTTTCAGAAACGGGTCAAGGAGTTGGATTCGGGTGTTGGGTTGAGGTACTTTTGGGTTTTCGTTAGGCATCCCAAGTGG
AGGCTGAGTGAGTTGCCGTGGGAGCAGTGGACGTTGGTGAGTGAGGTCGTTGTGGAGGCGGATAAGAAGAAGAGGTTGGA
TAAGTGGAACTTGATGGGGAGGTTGGGGAACAAGTCGAGGTCTTTGATATGCCAGTGCGCGGCTTGGTTTAGGCCTGATA
TTGTCTATGTGAAGAAGCCTGTGTTTCAGTGTAGGTTCGAGCCTCAGGAAGATTTTTTTAACTCGATTGTGCCTTATTTG
AACCCTGTGACGGAGGCTGGATTTGTTTTTGAGGTGGAGGATGATGATGGTGGGGTGGAGTTGAGTACTTACTATGGAGG
GTTGTGTAAGATGTTGAAGGTGAGGCAGACGGCTTTTGTGGATGATGTGGTGAAGGCTTATGAGAAGTGTAGCGATGAGA
AGAAGTCTAAGGTTTTGAGGTTTTTGCTTGGGAACCATCCTATTGAGTTGTTGCATCCGTATACGAAGGAGTGGAAAGCG
AAGCTGGAGGAGATGGAGCTTGGGTGTGATGCTCCGGATGAAGACGAGGATGAGGTGATTAATAGTGGGAGCTCGGAGAA
GGCTGAGTTTTCTGAATGGGTTGAAGATGAAGGTGGTGATAGCGAGATGGAGGAAGAAGAAGAAGAGGATGATGATGATG
ATAATATGGTTGTTGATGTGGAAGGGAACGTGGAAGAAGACAGTTTGGAAGGTGAAGTAGATGAGGTTGATCAGGAAGAG
GATGAGAGGTATTGGGAAGAGCAATTCAAGAAAGCGACAAGTAATGCAGAGAGGATGGAGAAGCTTGCGGAGATGAGCAT
GGTGGTGTCAGATCAGTTTTATGAGAAGCAGTTAAAGGCAATGGCGGAAAGAGAAGATGGAGATGGAGATCTTGGAGGAG
ATGAGTTGGAGATGAGAGGTAAGAAGGCGAAAGTGAAGCCAGAAGAATGGAAGACAGTAGGATATGGAAGGTGGATGAAG
AAGATAAAGAAGAGTAGAATCCCACCTGAGCTCTTTCTTCGTGCAGCTGTTAGGCCCTTTGTTTACAGAAACCTTGTGAA
AGAGATTGTTCTGACAAGACACGCTATTTTGGAAGGCGAGATTGGCCAAAATGAGTGA