Details for Kale Locus Bo5g127610

Position : C5 ( 5`- 39662404 .. 39664372 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127610

Protein [Map View]
MAKRIHLTELGCIACEELTELGAGKEGWLVNNPNLLSALDSHSIALAHRFLILIVNWADPDSLRVKIRPDLSPIEAESIT
AIEWLVFDDVRVVLAGTSCGYLLVYSIAGDLIHKQLVHPSRILKLRVRGTKKDLMQETSSEEISIVLPGIIARFDGSNIQ
SMLQKWFQEKNSNFWDQKSKKSDPEDTGSLHQRLPYQIWNVNKNGVCVDATITGIMPPPLLEHQSSQRYYCAVTIGEDAV
ISAYRLSEDRGRSLVGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGEKLTLSPS
GTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKGKSVFHSEPVKSDYCLCLAIHAPRKGIIEVWQMR
TGPRLLTIQCGKGSKLLQPAYRFGSNSSSSPYIPLEVFLLNGDSGQVSMLNRSLS*

DNA
ATGGCGAAGAGGATACACCTGACGGAACTAGGCTGCATCGCGTGCGAGGAACTCACCGAGCTCGGCGCGGGAAAGGAAGG
TTGGCTCGTGAACAATCCAAACCTTCTCTCCGCACTCGATTCCCACTCTATAGCCCTAGCCCATCGATTCCTCATCCTGA
TCGTGAATTGGGCTGATCCCGACTCTCTTCGCGTCAAGATCAGACCCGATCTGTCTCCCATCGAGGCGGAATCTATCACA
GCGATCGAATGGTTAGTGTTTGACGACGTCAGAGTCGTCCTCGCCGGAACCTCCTGTGGTTATCTCCTGGTTTACTCTAT
CGCCGGTGATCTGATTCATAAACAGTTGGTGCATCCTAGCCGTATATTGAAACTAAGAGTACGTGGCACTAAAAAAGATT
TGATGCAAGAGACATCTTCTGAGGAGATTAGCATTGTGTTGCCTGGCATTATTGCTCGCTTTGATGGCTCTAACATTCAG
AGTATGCTTCAGAAATGGTTTCAAGAAAAAAATTCAAACTTTTGGGACCAAAAGAGTAAAAAGAGTGATCCGGAAGATAC
TGGGAGTTTGCACCAACGGTTACCGTATCAGATATGGAATGTCAACAAGAACGGTGTGTGCGTTGATGCTACTATCACTG
GCATAATGCCTCCTCCGTTACTGGAACATCAGTCAAGTCAACGTTATTACTGTGCAGTGACCATTGGAGAGGATGCTGTA
ATCTCCGCTTACAGGCTCTCAGAGGATAGAGGTAGGTCGCTTGTCGGAGCTATTCTATCAAAAGTTGTGCCTGCAGCTGC
TTCGACCATTGCTTCTTTTTCAAAACTGATCTGGAGAAGTAATGATCAGTCACCAAAGCGAAAGCCAGAAGCTAAGACTC
AATCATTCGCTCGAGCTTCATCCTTGACATGTATAAAGGACTACCCAAGAAAAGGCGAGAAGCTGACGTTATCCCCGAGC
GGGACATTAGCTGCTATAACAGATTCTCTTGGTCGTATACTTCTGCTAGACACTCAAGCTCTCGTGGTTGTCCGATTATG
GAAGGGTTATCGTGACGCTAGCTGCGTGTTCATGGAGATGTTAGCCAAAAAAGATAAAGGAAAATCTGTATTTCACTCAG
AACCGGTGAAAAGCGATTACTGTTTATGCTTAGCCATTCACGCACCACGCAAAGGCATCATCGAGGTGTGGCAGATGAGA
ACGGGGCCGCGTCTTCTAACGATTCAATGTGGGAAAGGTAGCAAGTTGTTGCAGCCTGCGTACAGGTTTGGATCAAACTC
TTCATCTTCTCCTTACATTCCTCTTGAAGTCTTTTTGCTCAATGGAGATTCCGGCCAAGTCTCTATGCTTAACCGATCTC
TGTCTTAA