Details for Kale Locus Bo5g127600

Position : C5 ( 5`- 39659641 .. 39661265 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127600

Protein [Map View]
MSLSSPTSACSSSRCYSSGLSLPIGFRSSPINVGLVSYPRRHTNSPRKLVIASSSSSSSSSSSDPLLVKAAKGEAVSRPP
AWMMRQAGRYMSVYKKLALKHPSFRERSENTDLIVEISLQPWQAFKPDGVIIFSDILTPLPAFGVPFDIEEVKGPVIQSP
IRTEDDLKKLHPIDLDKLHFVGDSLKILRQEVGEHAAVLGFVGAPWTIATYIVEGGTTRTYTVIKSMCHTAPNVLRALLS
HLTKAITEYVVYQVEHGAHCIQIFDSWGGQLTPEMWERWSKPYIEEIIHAVKRRCPETPIVFYINGNGGLLERMKGTGAD
VIGLDWTVDMADGRRRLGSDVSVQGNVDPAFLFSPLPALTEEIHRVVKSAGPKGHILNLGHGVLVGTPEEAVAHFFETAR
SLDYKTFFQNHVPAESELVA*

DNA
ATGAGTTTATCATCACCAACCAGTGCTTGCAGCTCGTCGAGATGTTACTCCTCAGGCTTATCGTTGCCGATAGGGTTCCG
ATCAAGTCCCATCAATGTGGGATTAGTTTCTTACCCAAGAAGACACACTAACTCTCCTCGGAAGCTCGTCATAGCTTCCT
CCTCATCCTCATCCTCATCCTCATCCTCAGATCCTTTATTGGTTAAAGCTGCTAAAGGGGAAGCAGTGTCTCGCCCTCCA
GCTTGGATGATGAGGCAAGCAGGAAGGTACATGTCCGTCTACAAAAAGCTAGCCCTGAAGCACCCTTCCTTCAGAGAGAG
ATCAGAGAACACTGACCTCATTGTGGAGATCTCTCTGCAGCCTTGGCAAGCTTTTAAACCCGACGGTGTCATCATCTTCT
CCGACATCCTCACTCCCTTACCCGCCTTCGGCGTCCCTTTCGACATCGAAGAAGTCAAAGGCCCCGTGATCCAGTCCCCC
ATCAGAACCGAAGATGATCTCAAGAAGCTGCATCCCATTGATCTTGATAAGCTTCACTTCGTTGGAGACTCTCTGAAGAT
ACTGAGGCAAGAGGTCGGGGAGCATGCTGCTGTGTTGGGTTTCGTTGGAGCGCCGTGGACGATAGCGACTTATATAGTTG
AAGGAGGGACGACTCGGACGTATACGGTGATCAAGAGTATGTGTCACACTGCACCTAATGTACTGAGAGCTCTTTTGTCT
CATTTGACTAAAGCAATCACGGAGTATGTTGTGTACCAAGTTGAGCACGGAGCTCACTGCATACAGATATTTGATTCGTG
GGGTGGGCAGTTGACTCCTGAGATGTGGGAGCGCTGGTCCAAACCTTACATTGAAGAGATCATTCATGCTGTGAAGAGAA
GATGTCCAGAGACGCCGATAGTTTTCTACATCAATGGAAACGGTGGCCTTCTTGAGCGGATGAAAGGAACCGGAGCTGAT
GTTATTGGACTTGACTGGACTGTAGATATGGCTGATGGAAGGAGGAGACTGGGGAGCGATGTTAGTGTGCAGGGGAATGT
TGATCCAGCTTTCCTATTCTCTCCGCTTCCTGCTTTAACTGAAGAGATTCATAGAGTTGTAAAGAGTGCTGGACCAAAAG
GGCATATACTCAACTTAGGACATGGAGTCTTGGTAGGGACACCAGAGGAAGCCGTAGCTCATTTCTTTGAAACGGCAAGG
AGCTTGGATTACAAAACGTTTTTCCAAAACCATGTTCCTGCAGAATCTGAATTGGTTGCCTGA