Details for Kale Locus Bo5g127590

Position : C5 ( 5`- 39652645 .. 39656563 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127590

Protein [Map View]
MAGRNIEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQELYELSAEYEGKRDPKKLEELG
SVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIKKLKKGDFADESSATTESDIEETFKRLVSVLGKSPEEIFDA
LKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANFYYNQIE
NLMFELSMWRCTDEFRAKADEIHRNSRKDAAKHYIEFWKTIPPTEPYRVILGDVRDKLYHTRERSRQLLSNGISDIPAEA
TFTNVEEFLEPLELCYRSLCACGDRPIADGSLLDFLRQVSTFGLSLVKLDIRQESERHTDVFDAITKHLDGSSYRDWSEE
RRQEWLLAELSGKRPLFGPDLPKTEEIADVLDTFKVISELPSDCFGAYIISMATSPSDVLAVELLQRECHVKKPLRVVPL
FEKLADLEAAPAAVSRLFSLDWYKNRINGKQEVMIGYSDSGKDAGRLSAAWELYKAQEELVKVAKKYGVKLTMFHGRGGT
VGRGGGPTHLAILSQPPDTVNGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPVSPKPEWRALLDAMAVVA
TEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAFRYAIKK
DVRNLHMLRDMYKHWPFFRVTIDLIEMVFAKGDPGIAALYDKLLVSEDLWAFGEKLRTNFEETKSLVLQTAGHRDLLEED
PYLKQRLRLRDSYITTLNVCQAYTLKRIRDQNYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLILTMKGIA
AGLQNTG*

DNA
ATGGCGGGTCGGAACATAGAGAAGATGGCGTCCATTGATGCGCAGCTTCGTCAACTGGTTCCTGCTAAAGTGAGTGAAGA
CGACAAGCTCATCGAGTACGACGCTCTTCTCCTCGATCGTTTCCTCGACATTCTCCAGGACTTACACGGAGAGGATCTCC
GTGAAACGGTACAAGAGCTGTACGAGCTCTCTGCTGAGTATGAAGGCAAACGTGACCCTAAGAAGCTTGAGGAGCTAGGG
AGTGTGCTCACGAGTTTGGATCCTGGCGACTCCATTGTTATCTCCAAGGCCTTCTCCCACATGCTTAACTTAGCTAACTT
GGCTGAGGAGGTCCAGATTGCTTACCGGAGAAGGATCAAGAAGCTGAAGAAGGGTGATTTCGCTGATGAGAGCTCTGCCA
CTACCGAGTCTGATATCGAAGAGACTTTCAAGAGGCTTGTTAGTGTTCTTGGTAAGTCTCCTGAAGAGATCTTTGATGCT
TTGAAGAACCAGACTGTGGATTTGGTTTTGACTGCTCATCCTACTCAGTCTGTGCGTAGATCTTTACTTCAGAAGCACGG
CAGGATAAGAGACTGTCTAGCTCAGTTGTATGCAAAGGACATTACTCCTGATGACAAGCAGGAGCTTGATGAGTCTTTGC
AAAGAGAGATTCAAGCTGCATTCCGCACAGATGAGATTAGGAGAACGCCTCCAACCCCACAAGATGAAATGAGAGCTGGA
ATGAGCTATTTCCATGAGACAATCTGGAACGGTGTCCCTAAGTTCCTTCGCCGTGTTGACACAGCTCTGAAGAACATTGG
GATTGACGAACGTGTTCCTTACAATGCCCCACTGATTCAGTTCTCTTCATGGATGGGCGGTGATCGTGATGGTAATCCGA
GGGTCACACCTGAGGTCACTAGAGATGTGTGCTTGTTGGCTAGAATGATGGCAGCCAATTTCTACTATAACCAAATTGAA
AATCTGATGTTTGAGTTGTCTATGTGGCGTTGCACTGATGAGTTTCGTGCCAAGGCTGATGAGATCCACAGGAACTCAAG
GAAAGATGCTGCAAAACATTACATAGAGTTCTGGAAGACAATTCCTCCAACTGAGCCATACCGTGTGATTCTTGGTGATG
TGAGGGACAAACTCTATCACACACGCGAACGCTCTCGTCAGTTGCTGAGTAACGGAATCTCTGACATCCCCGCAGAAGCT
ACTTTCACCAATGTCGAAGAGTTCTTGGAGCCTCTTGAGCTCTGTTACCGATCACTATGTGCATGTGGTGACCGCCCAAT
AGCTGATGGAAGCCTCCTTGATTTCCTGAGGCAAGTCTCTACCTTTGGACTCTCCCTTGTGAAGCTTGACATTAGGCAAG
AATCTGAACGCCACACCGATGTCTTTGACGCTATCACCAAGCACTTAGACGGTTCCTCCTACAGAGACTGGTCTGAAGAA
CGTCGGCAAGAATGGCTTCTTGCTGAACTAAGCGGCAAGCGTCCGCTATTCGGACCAGATCTTCCGAAAACCGAAGAGAT
TGCTGATGTTCTGGACACATTCAAAGTCATCTCCGAGCTGCCTTCAGATTGCTTTGGAGCTTACATTATCTCTATGGCAA
CTTCACCCAGTGATGTCCTTGCCGTTGAGCTTTTACAGCGCGAGTGCCACGTGAAGAAGCCACTCAGAGTTGTTCCACTC
TTTGAGAAGCTAGCTGATCTAGAAGCAGCTCCTGCAGCTGTTTCAAGACTCTTCTCTCTGGACTGGTACAAAAACCGCAT
TAACGGTAAACAAGAGGTTATGATCGGTTACTCTGACTCAGGGAAAGACGCTGGTCGTCTCTCAGCTGCTTGGGAGCTGT
ACAAAGCTCAAGAAGAGCTTGTGAAGGTCGCTAAGAAATATGGAGTGAAGCTAACTATGTTCCATGGCCGTGGTGGCACT
GTTGGAAGAGGAGGTGGTCCCACCCATCTTGCTATATTGTCTCAGCCACCGGATACAGTTAATGGCTCACTCAGAGTCAC
GGTTCAAGGTGAAGTCATTGAGCAATCGTTTGGAGAGGAACACTTGTGTTTTAGAACACTTCAGCGTTTCACAGCTGCTA
CTCTTGAGCATGGTATGAACCCTCCTGTTTCGCCAAAACCAGAGTGGCGCGCTTTGCTCGATGCAATGGCGGTTGTTGCA
ACCGAGGAGTATCGATCCGTCGTGTTCCAAGAACCTCGATTTGTCGAGTACTTCCGCCTTGCTACACCTGAGCTGGAGTA
TGGACGTATGAACATCGGAAGCAGGCCTTCAAAGCGAAAACCGAGCGGTGGGATCGAGTCTCTCAGAGCAATCCCATGGA
TCTTTGCTTGGACACAAACAAGATTCCATCTTCCTGTATGGTTAGGATTTGGAGCAGCTTTCAGGTATGCAATCAAGAAA
GATGTGAGGAACCTCCACATGCTGCGAGATATGTACAAACACTGGCCTTTCTTCCGAGTCACCATCGATCTTATTGAGAT
GGTGTTCGCCAAGGGAGACCCGGGGATCGCTGCATTGTACGACAAGCTTCTTGTCTCTGAAGACTTATGGGCCTTTGGAG
AGAAACTCAGAACCAACTTTGAAGAAACCAAGAGCCTCGTCCTCCAGACTGCCGGACACAGAGACCTTCTTGAAGAAGAC
CCTTACTTGAAACAAAGGCTTAGGCTGCGTGACTCTTACATTACAACCCTCAACGTTTGCCAAGCCTACACATTGAAGAG
AATCCGTGATCAAAACTACAATGTGACTCTGCGACCACACATTTCTAAAGAGATCATGCAATCAAGCAAATCGGCACAAG
AGCTAGTTAAGCTTAACCCAACGAGTGAATACGCGCCTGGACTTGAGGACACGCTCATCTTAACCATGAAAGGTATTGCC
GCAGGACTGCAAAACACCGGTTAA