Details for Kale Locus Bo5g127580

Position : C5 ( 5`- 39648914 .. 39651579 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127580

Protein [Map View]
MLKPIKHVSEPDTVADKLRRSLNMTNNKQDNVHVEFGSPITPLQTQPSGLTSAATTTSNSSFSSSSSGSVSGRAVHTPAS
TKSDSGRSNPSAVQSSRATAPSASQTSKTSNPSAAKSSKSTTSGSSNPAGAKAGSNPRPGRVSSASDSASGSTKRSTKSS
TPPPQPVKILPGGNLFPSGKVHITGMTQGVPKRMILGPGSKSYGYGSVMRGTNSYSSTPAKLTTSSGSSSGALVISRCSS
GGGGSEVDTSWKRVMNSPNPEEVKRLGNEMFKKGCFSEALKFYDRALELSPSNATYRSNRAAALSGLGRIAEAVVECEHA
IKLDPNFARAHHRLATLLLRLGQVDNAGKHFFSVEEPSDPMVVKVLEEVDRHLNKCADARRCGEWNVVLTEVSAAMESGA
DMSPQLAMCKVEALMKLLRLDEAQTILASAPKIEILLPSSFTRIRFFDMISEAYTYFVKSQMELALGRFENAVTFIEKAS
EMEPRNGEIETLNRNVKMIVRARDRGNGLYGSERYTEASAAYAEGLKFDPYNATLFSHRADCFFKVGMWESSIEDCSHAL
LILPSCTKARRQRAASYSKLERWTEAVSDYEILRKELSYDREIAESLFHAQVALKKSRGEVVLNMEFGGEVEEVFSLEEL
KAALTRPGVSVVLFMKAFDQQCKEISIFMDALCIRYPSLHFLKVEIEKCPEVGDAEKVRVVPTFKIYKVGIRMKEIVCPS
KEALEISVRHYGL*

DNA
ATGTTGAAGCCCATTAAACATGTGTCGGAACCTGACACTGTCGCCGATAAGCTTCGCAGATCACTGAATATGACAAACAA
TAAACAAGACAATGTTCATGTCGAATTCGGATCGCCAATTACTCCGCTTCAGACACAACCGAGTGGACTCACCTCGGCGG
CAACCACCACTTCCAACAGTAGCTTCAGTTCTAGCTCATCCGGATCGGTATCGGGTCGTGCCGTACACACTCCGGCTTCA
ACAAAATCCGACTCCGGTCGGTCAAATCCCTCCGCCGTACAATCTTCTAGGGCCACCGCTCCCTCCGCCTCTCAAACTTC
TAAGACAAGCAATCCCTCCGCCGCTAAATCTTCCAAGTCCACCACTTCCGGGTCTAGCAACCCCGCCGGCGCTAAAGCAG
GGTCGAACCCGAGACCGGGACGGGTCTCTTCAGCGTCGGACTCAGCTTCTGGCTCAACAAAACGATCAACAAAAAGCTCG
ACTCCGCCGCCGCAGCCGGTGAAAATCCTCCCCGGCGGGAATCTTTTCCCGTCCGGGAAGGTTCATATAACAGGGATGAC
ACAAGGAGTTCCCAAACGCATGATTCTCGGACCAGGCTCCAAGTCCTACGGATACGGTAGCGTAATGCGAGGAACAAACA
GCTACTCGTCAACGCCTGCAAAGCTAACAACGAGTTCTGGTTCTTCCTCCGGTGCACTCGTAATCTCCCGCTGCTCTAGC
GGTGGTGGTGGCTCTGAGGTGGATACGTCGTGGAAGAGAGTGATGAATAGTCCGAATCCAGAGGAAGTAAAGAGGCTTGG
AAACGAAATGTTCAAGAAAGGTTGTTTCAGTGAGGCTTTGAAGTTTTACGACCGAGCGTTAGAGCTCTCGCCGAGTAATG
CGACTTACCGCAGCAACCGAGCAGCTGCTTTGTCCGGTTTAGGTCGGATTGCTGAAGCTGTGGTTGAGTGTGAACATGCT
ATTAAACTGGATCCGAATTTTGCAAGGGCTCATCATCGTTTAGCCACATTGCTTCTTAGATTAGGTCAAGTTGATAATGC
GGGGAAGCACTTCTTTTCTGTGGAGGAGCCATCAGATCCCATGGTGGTGAAGGTGCTTGAAGAAGTTGATAGACACTTGA
ACAAATGCGCAGATGCAAGAAGATGTGGTGAATGGAATGTTGTTTTGACAGAAGTAAGTGCAGCTATGGAGTCTGGAGCT
GATATGTCTCCTCAGCTAGCTATGTGTAAAGTTGAAGCACTAATGAAGCTCCTAAGGCTTGATGAGGCTCAGACAATATT
AGCATCTGCCCCCAAAATAGAAATATTATTACCATCATCTTTCACACGGATTCGGTTTTTCGATATGATCTCTGAAGCTT
ACACATATTTTGTAAAATCTCAGATGGAATTGGCTCTAGGAAGGTTTGAAAATGCGGTTACATTTATAGAGAAAGCTTCA
GAGATGGAACCACGAAACGGTGAAATTGAAACATTGAATAGAAACGTTAAAATGATTGTTAGGGCGCGTGATCGTGGTAA
CGGTCTTTATGGCTCAGAAAGATACACAGAAGCAAGTGCAGCTTATGCAGAAGGCCTTAAGTTTGATCCATACAATGCTA
CTTTGTTCAGTCATAGAGCTGATTGTTTCTTTAAAGTTGGGATGTGGGAGAGCTCAATAGAAGATTGTAGTCATGCATTG
CTTATTCTACCGAGTTGCACAAAGGCTCGTCGTCAAAGAGCTGCCTCATACAGCAAGCTGGAGAGATGGACTGAAGCAGT
TAGCGATTATGAAATCTTGAGAAAGGAACTATCTTATGACAGAGAAATAGCTGAGTCTTTGTTTCATGCTCAAGTTGCAT
TGAAGAAATCTCGTGGAGAAGTAGTTTTAAACATGGAGTTTGGAGGTGAAGTTGAGGAGGTTTTTAGCCTTGAAGAGTTA
AAAGCTGCATTGACACGTCCTGGAGTTTCTGTTGTACTTTTTATGAAAGCCTTTGATCAACAATGCAAAGAGATATCTAT
TTTCATGGATGCACTATGTATTCGTTACCCATCACTGCACTTCCTCAAGGTGGAGATAGAGAAATGTCCTGAAGTGGGTG
ATGCAGAGAAAGTGAGAGTTGTGCCAACCTTCAAGATTTACAAAGTTGGGATTAGGATGAAGGAGATTGTGTGCCCAAGC
AAGGAAGCACTGGAGATTTCAGTGAGACACTATGGCCTTTAG