Details for Kale Locus Bo5g127570

Position : C5 ( 5`- 39642486 .. 39644258 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127570

Protein [Map View]
MPSSPRLKLFHARTSPSTRRSTSLIVLTSLAIGLFGFIFGLSAIVFPSRTCLTNSPPKTVRVVWDVAGNSNGGNGLSGGV
KRHKVMGFVGIQTGFGSAGRRRALRSTWMPSDPEGLRRLEESTGLAIRFIIGKTKDEKKMAELRREIAEYDDFILLDIEE
EYSKLPYKTLAFFKAAYALYDSEFYVKADDDIYLRPDRLSLLLAKERSHSQTYLGCLKKGPVFTDPKLKWYEPLADLLGK
EYFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLAMNVNHENHKTLCERECSPYSIAVWDIPKCSGLCNP
EKRMLELHKIESCSKSPTLPSEDE*

DNA
ATGCCGTCTTCTCCGAGGCTGAAGCTCTTCCACGCGCGGACATCACCCTCCACGCGCCGATCGACGTCTCTGATCGTCCT
CACCTCTCTCGCGATCGGGCTATTCGGATTCATCTTCGGACTCTCCGCCATTGTTTTCCCGAGCCGGACATGCCTCACGA
ACTCCCCTCCGAAGACGGTGCGAGTCGTCTGGGACGTCGCCGGGAATAGTAACGGTGGTAATGGCCTCAGCGGCGGAGTG
AAGAGGCATAAGGTGATGGGATTCGTCGGTATCCAAACCGGATTCGGATCAGCTGGGAGGAGACGAGCGCTCAGGAGCAC
GTGGATGCCGTCCGATCCAGAAGGACTTCGTCGCTTGGAGGAGTCAACAGGATTGGCTATCAGGTTTATCATAGGCAAGA
CCAAAGATGAAAAGAAGATGGCTGAGCTTAGAAGGGAGATTGCAGAGTATGATGACTTTATACTGCTCGATATCGAGGAG
GAGTACAGTAAGCTCCCATACAAAACTTTGGCTTTCTTCAAAGCTGCATATGCTTTGTATGATTCGGAGTTCTATGTCAA
AGCTGATGATGATATATATTTGAGGCCAGATCGTTTGTCTTTGCTGTTGGCTAAAGAGAGGAGCCACTCGCAGACATACC
TAGGATGCTTGAAAAAAGGTCCTGTTTTCACAGATCCAAAGCTTAAATGGTATGAGCCTTTGGCAGATTTGCTGGGGAAG
GAGTACTTTCTTCATGCTTATGGCCCCATCTATGCTCTTTCTGCTGATGTTGTCACCAGTTTGGTTGCCCTCAAGAATAA
CAGTTTCAGGATGTTTAGCAACGAGGACGTGACAATAGGTGCGTGGATGTTGGCAATGAACGTCAACCACGAGAACCACA
AGACCCTTTGTGAACGAGAGTGCTCACCCTACTCCATTGCTGTTTGGGATATACCAAAATGCTCAGGGCTTTGTAACCCA
GAGAAAAGGATGTTGGAACTTCACAAGATAGAGAGCTGCTCAAAGAGCCCAACTTTGCCATCGGAAGATGAGTGA