Details for Kale Locus Bo5g127540

Position : C5 ( 5`- 39606885 .. 39609109 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127540

Protein [Map View]
RLCTISTPQVTLLSSKLNSNSIIQYTIFVTLQLSLSLSRILETMASSTKTVLIPIAHGTEPLEAVAMITVLRRGGADVTV
ASVEDKVGVDACHNIKMVADTLLSDITDSIFDLIVLPGGLPGGETLKNCKPLENMVKKQDTDGRLNAAICCAPALALGTW
GLLEGKTATGYPVFMEKLAATCATASESRVEIDGRIVTSRGPGTTIEFSITLIEQLFGKDKADEVSTILLVRPNPGEEFT
FTELNQTNWSFEDTPQILVPIAEDSEEIEAIALVDILRRAKANVVIAAVGNSLEVVGSRKAKLVADVLLDEVAEKSFDLI
VLPGGLNGAPRLASCEKLVNMLKKQAEANKPYGGICASPVYVFEPNGLLKGKKATTHPVVSDKLSDQSHIEHRVVVDGNV
ITSRAPGTAMEFSLAIVEKFYGREKAVQLAKATLV*

DNA
AGACTCTGCACTATATCAACCCCACAAGTGACACTCCTTTCCTCTAAACTAAACTCCAACTCCATTATTCAATATACAAT
CTTCGTGACTCTACAGTTGTCTCTCTCTCTCTCTCGAATCTTAGAAACTATGGCTTCATCTACTAAGACGGTTTTGATCC
CTATTGCTCACGGTACCGAGCCACTAGAAGCAGTGGCGATGATCACCGTGTTGCGCCGAGGTGGTGCTGACGTGACGGTG
GCCTCTGTCGAGGATAAAGTTGGCGTTGATGCTTGTCATAACATCAAGATGGTCGCCGATACTCTCCTCTCCGATATCAC
CGACTCTATTTTCGACCTTATTGTGCTCCCCGGAGGGCTTCCGGGTGGCGAGACTCTTAAAAACTGTAAGCCTCTCGAGA
ACATGGTGAAGAAACAAGACACAGATGGAAGACTTAACGCAGCTATATGTTGCGCTCCTGCTTTGGCTCTTGGTACTTGG
GGTCTTCTAGAGGGCAAAACAGCAACTGGTTACCCGGTTTTCATGGAGAAACTTGCGGCTACTTGTGCAACTGCAAGTGA
GTCAAGAGTGGAGATAGATGGAAGGATTGTGACAAGTCGTGGACCAGGAACCACCATTGAATTCTCCATCACTCTTATTG
AGCAGTTGTTTGGGAAAGACAAAGCTGATGAAGTCTCTACTATCTTGTTGGTTCGTCCTAACCCTGGTGAGGAGTTTACC
TTTACCGAGCTTAACCAAACAAACTGGTCATTCGAAGATACTCCACAGATTCTTGTTCCCATTGCAGAGGACTCAGAGGA
AATTGAAGCTATTGCGCTTGTAGATATTCTAAGGAGGGCAAAAGCAAACGTCGTGATTGCTGCAGTTGGTAATAGTTTGG
AAGTTGTAGGATCCCGCAAAGCTAAGTTAGTAGCAGATGTGCTTCTTGATGAAGTTGCAGAGAAGTCGTTTGATCTGATT
GTGTTGCCTGGAGGTCTTAACGGTGCTCCAAGATTGGCAAGCTGCGAGAAACTGGTGAATATGTTAAAGAAACAAGCGGA
AGCAAACAAACCATATGGAGGAATCTGCGCATCACCTGTTTACGTCTTTGAGCCTAATGGTTTACTCAAGGGTAAGAAGG
CAACTACACACCCAGTGGTGAGCGACAAACTTTCGGACCAGAGTCACATCGAGCACAGAGTTGTTGTGGACGGGAATGTG
ATAACGAGCAGAGCTCCAGGGACCGCAATGGAGTTTTCACTTGCGATTGTTGAGAAGTTTTATGGGCGAGAGAAAGCGGT
TCAGCTCGCCAAGGCAACACTTGTGTAA