Details for Kale Locus Bo5g127510

Position : C5 ( 5`- 39592846 .. 39594656 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127510

Protein [Map View]
MTEYLVDILFGSEIPKTPSLSVPTIKPSQNPRPSSHFARVLYLSMATHSISRSILCRPAKSLSLLFTRSFASSAPLAKAP
ATSLYTSSLLTRSRPLVAAFRGGLVSVKGLSSQATSSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVVDPPEGDPTRDE
IIDSYIKTLAQIVGSEEEARMKIYSVSTRCYFAFGALVSEDLSHKLKELPKVRWVLPDSYLDVRNKDYGGEPFIDGKAVP
YDPKYHEEWIRNNARANERNRRNDRPKNFDRSRNFERRRENMAGGPPPQRPPMGGSAPPPPPMGQNYGQRPPPNYGGPPP
PHNNMGGLRPPANYGGAPPPPPNYGGPPPPNYGGTPPQNMGGAPPPNYGGSPPPNYGGAPPQNNMGGGGPPNAGWSGNNY
QQQQGGGMQQPQYQNNYPPNRDGSGNPYQG*

DNA
ATGACCGAATACTTGGTTGATATTTTGTTCGGCTCTGAAATACCGAAAACGCCCTCGTTATCAGTACCCACTATTAAACC
TTCGCAAAACCCTCGTCCTTCGTCACATTTTGCTAGGGTTTTGTATCTTTCCATGGCGACGCATTCCATCTCTCGCTCCA
TTCTCTGCCGTCCGGCGAAATCTCTCTCCCTTCTCTTCACCCGATCCTTCGCCTCATCTGCTCCTCTCGCCAAAGCTCCG
GCGACTTCGCTTTACACGTCGTCTCTGCTCACCCGATCCCGTCCCTTAGTCGCCGCCTTCCGCGGTGGACTTGTGTCTGT
CAAAGGTCTTTCTTCGCAGGCTACGTCGTCTTCTCTGAACGATCCGAGTCCCAACTGGTCCAACAGGCCTCCAAAGGAGA
CGATTTTGCTCGATGGATGCGATTTCGAGCATTGGCTTGTGGTTGTGGATCCGCCTGAGGGAGATCCCACTAGAGATGAG
ATCATCGACAGCTATATCAAAACCCTAGCTCAGATCGTTGGCAGTGAAGAAGAAGCGAGGATGAAGATCTACTCTGTTTC
AACTCGGTGCTACTTTGCTTTTGGAGCTCTTGTGTCTGAAGATCTCTCTCACAAGCTGAAAGAGTTGCCAAAGGTGCGCT
GGGTTCTTCCTGATTCTTACCTGGATGTGAGAAACAAAGACTACGGAGGGGAACCTTTCATTGATGGGAAAGCTGTTCCT
TATGACCCCAAGTACCACGAGGAATGGATAAGGAACAACGCTAGAGCCAATGAAAGAAACAGGCGCAATGACCGTCCTAA
AAACTTTGATAGAAGCAGAAACTTTGAGAGGAGAAGAGAGAACATGGCTGGAGGCCCTCCTCCTCAACGTCCTCCCATGG
GTGGCTCTGCACCCCCTCCACCTCCCATGGGGCAGAATTATGGACAAAGGCCTCCACCAAACTATGGAGGACCACCACCG
CCACATAACAATATGGGAGGGCTGAGGCCTCCAGCAAACTACGGAGGCGCACCACCACCACCACCGAACTATGGAGGACC
ACCACCACCGAACTACGGAGGAACGCCACCACAAAACATGGGAGGAGCACCACCACCAAACTACGGAGGATCACCTCCAC
CGAACTATGGAGGAGCACCACCGCAGAACAACATGGGAGGGGGAGGTCCACCAAATGCAGGATGGTCAGGTAACAACTAC
CAGCAGCAGCAGGGTGGTGGAATGCAGCAGCCACAGTACCAGAACAACTATCCACCTAACCGGGATGGCAGCGGGAACCC
GTACCAGGGTTAA