Details for Kale Locus Bo5g127500

Position : C5 ( 5`- 39573138 .. 39574352 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127500

Protein [Map View]
MADEAHHFLHPPAPPPPSSMRHREAANGGCGEIVEVQGGHIVRSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDVQD
RLGFDRPSKAVDWLIKKAKASIDELAQLPPWNPADAMRNAAANAKPRRTAAKTRISPSPPPPPPSQQQQQQLQFGGFEGV
AEHRGNESSFLPPSMDSDSIADTIKSFFPVVGSTTEAPPPNQLMHSNYHHHPPNLLSRTNSHNQDLRLSLHSFPDGPPSL
LQHHHSASASTAEPVLFYGQSNPLGYDTSTGGWEQQSIQRLVAWNSGGATETGNGGGGGFLFAPPAATSFQPVLGQSQLY
SQRGPLQSSYSPMIRAWFDPHHHHHQSISTDDLNHHHHHIPQPVHQGEFSSGFRIPARFQGQEEEQHDGLSNKPSSASSI
SRHR*

DNA
ATGGCAGACGAAGCTCACCACTTTCTCCACCCTCCAGCACCACCACCGCCTTCTTCAATGAGGCACCGCGAGGCGGCGAA
CGGCGGCTGCGGCGAGATCGTCGAGGTGCAAGGAGGTCACATTGTTCGGTCGACGGGAAGGAAAGATCGGCACAGCAAAG
TCTGCACGGCCAAAGGGCCACGTGACCGGCGCGTGAGGCTGTCGGCTCACACGGCGATTCAGTTCTACGACGTTCAGGAC
CGCCTCGGCTTCGACCGGCCCAGCAAAGCCGTCGACTGGCTTATCAAGAAGGCTAAAGCTTCCATCGACGAGCTCGCTCA
GCTTCCGCCGTGGAACCCCGCCGACGCAATGCGCAACGCCGCCGCAAACGCGAAACCGAGAAGAACCGCCGCTAAAACTC
GAATCTCTCCGTCGCCGCCACCGCCGCCGCCGTCGCAGCAGCAACAGCAGCAGCTTCAGTTCGGTGGATTCGAGGGAGTG
GCTGAGCATCGGGGGAACGAGTCGAGTTTCCTCCCTCCGTCGATGGATTCGGATTCTATCGCTGACACTATAAAGTCGTT
TTTCCCGGTGGTTGGCTCTACAACGGAAGCTCCTCCTCCGAATCAGCTTATGCACAGCAACTACCATCATCACCCGCCGA
ATTTGCTTTCTCGAACCAATAGCCATAACCAAGATCTCCGTCTCTCGCTGCACTCGTTCCCGGATGGTCCACCGTCTCTT
CTCCAGCACCACCACTCCGCGTCCGCCTCCACCGCCGAGCCAGTTCTGTTCTACGGACAGAGCAATCCGCTAGGGTATGA
CACGTCGACGGGTGGTTGGGAGCAACAGTCAATTCAGAGGCTTGTGGCTTGGAACAGCGGCGGAGCAACCGAGACAGGAA
ACGGAGGAGGAGGAGGGTTTCTCTTTGCTCCGCCTGCGGCGACGTCGTTTCAGCCAGTACTTGGCCAAAGCCAGCTTTAT
TCTCAGAGGGGTCCCCTTCAGTCCAGTTACAGTCCCATGATCCGTGCTTGGTTTGATCCTCACCACCACCATCATCAATC
CATCTCCACCGACGATCTCAACCACCACCACCACCATATTCCTCAGCCGGTTCACCAAGGTGAATTCTCTTCCGGTTTCC
GCATACCAGCACGGTTTCAGGGTCAAGAAGAGGAGCAGCACGATGGTCTCTCCAACAAACCGTCATCTGCTTCCTCCATT
TCTCGCCATCGTTAA