Details for Kale Locus Bo5g127490

Position : C5 ( 5`- 39570663 .. 39571313 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127490

Protein [Map View]
MNKSPRIDIPSSSSPASVSADGELNEDDIFSIDVTHTPPSSSPSQHPPARQLQRSKSGLKNVEASGILAALPEPSGNSYL
NHVFHHKPAASSSPSSSSARTIPSAPKPPQERLPYTASFIGGGKFPQSAPVQVPLASLAMMNRHKKEFKLTDVVDEDEEE
EEEEGEMLPPHEIVARSLAKSSLLSCSVLEGAGRTLKGRDLRQVRNAVFRRTGFID*

DNA
ATGAACAAAAGTCCACGCATCGATATCCCTTCATCGTCTTCTCCAGCTTCAGTTTCTGCAGATGGTGAGCTCAATGAAGA
CGACATCTTCTCGATAGACGTAACTCACACTCCGCCGTCTTCTTCTCCTTCGCAACACCCACCTGCTCGCCAGCTTCAGA
GGAGCAAAAGCGGTTTGAAAAACGTGGAAGCTTCTGGTATCCTCGCTGCTCTTCCCGAACCTTCTGGCAACAGCTACCTC
AACCACGTCTTTCACCATAAGCCTGCAGCTTCTTCCTCGCCTTCTTCATCTTCCGCTAGAACCATTCCCTCAGCTCCTAA
ACCGCCTCAAGAGAGGCTTCCATATACAGCTTCTTTTATAGGTGGAGGGAAGTTTCCTCAGTCAGCTCCGGTTCAAGTGC
CGTTAGCATCTTTGGCCATGATGAATCGTCATAAGAAGGAGTTCAAGCTTACTGATGTGGTGGATGAGGATGAGGAGGAG
GAAGAAGAAGAAGGCGAAATGCTTCCTCCACATGAGATTGTAGCTCGGTCTTTGGCGAAGTCTTCTTTATTGTCTTGCTC
GGTTCTTGAAGGAGCTGGAAGAACACTTAAAGGGAGAGATCTCCGGCAGGTAAGGAATGCTGTTTTCAGAAGAACCGGTT
TCATAGATTGA