Details for Kale Locus Bo5g127470

Position : C5 ( 5`- 39559189 .. 39563323 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127470

Protein [Map View]
MSSDLKRKPKKKNPKPVQINPNWSLLQQKLKSDSNNSGNRKSSNNDDSDNPRSILGKRKERPDTEVDVPKISPLAPVNDD
SSLTDEVAMDCEMVGVSQGTKSALGRVTLVNKWGNVLYDEFVRPVERVVDFRTHISGIRPRDLRKAKDFRVAQTKVAELI
KGKILVGHALHNDLKVLLLTHPKKDIRDTAEYQPFLKYFSHLTNPSFLSSSCPNEPICNLPNRDKTRKSLKHLASEFLGA
DIQNGEHCPIDDARAAMLLYQKNRREWERNVKDQTRMRLKQKKQEADFRIDGGEIRVMRSLRGSSMAGLVSHPARLSSLR
SIFTGCRAVMLPRFGGPEVLELRENVPVPNLNPNEVLVRARAVSVNPLDCRIRAGYGRSVLQPHLPVIIGRDISGEVAAV
GNSVKAFKVGQEVFGALHPTALRGTYTDYGILSEEELTEKPSSVSHVEASAIPFAALTAWRALKSNARILEGQRLLVFGG
GAVGFAAIQLGVAFGCHVTASCVGQTKDRILAAGAEQAVDYLTEDIEVAVKGKFDAVLDTIGRPETERIGINFLRKGGNY
MTLQGEAASLTDRYGFLIGLPLATSLLAKKKIQYQYSHGIDYWWTYMRADPEGLAEIQRLVGAGKLKIPVEKTFPITEVV
AAHEAKEKKLVPGKVVLEL*

DNA
ATGAGTTCTGATCTGAAGAGAAAGCCGAAGAAGAAAAACCCTAAACCCGTTCAGATAAACCCTAATTGGTCACTCCTCCA
ACAAAAGCTGAAATCTGATTCGAATAACTCGGGAAATCGAAAATCGTCAAACAATGACGACTCAGATAATCCTAGGTCCA
TATTAGGGAAGCGGAAAGAGAGACCTGATACGGAGGTGGATGTTCCTAAGATTAGTCCCTTAGCTCCGGTTAATGACGAT
TCCAGTTTGACAGATGAAGTGGCTATGGACTGTGAAATGGTTGGTGTCAGTCAAGGAACCAAAAGCGCCCTTGGACGTGT
TACCTTGGTAAACAAATGGGGAAATGTTCTGTACGATGAGTTTGTCCGTCCAGTGGAACGTGTTGTTGACTTTCGAACGC
ATATTAGTGGGATTCGACCTAGAGATTTAAGAAAGGCCAAAGATTTCCGAGTTGCTCAGACCAAAGTAGCGGAGTTGATC
AAGGGGAAGATTCTCGTGGGACATGCCTTGCACAACGATCTCAAGGTTTTGCTGTTAACTCACCCGAAAAAGGACATAAG
GGACACAGCAGAGTATCAGCCTTTTCTCAAGTATTTCTCACATCTCACCAACCCCTCTTTTCTCTCTTCATCTTGTCCTA
ATGAACCCATCTGTAATCTTCCAAACAGGGACAAAACAAGAAAGTCTCTGAAACATCTTGCATCTGAGTTTCTAGGGGCC
GACATCCAAAACGGAGAGCACTGTCCTATTGATGATGCAAGAGCTGCAATGCTGCTTTACCAGAAGAACAGAAGAGAGTG
GGAGAGAAACGTGAAAGACCAGACAAGGATGAGGCTGAAACAAAAGAAGCAAGAAGCAGATTTTCGCATCGACGGAGGAG
AAATACGAGTGATGAGATCATTGCGCGGTAGCTCTATGGCCGGATTGGTGTCTCATCCGGCGAGGTTAAGTTCCCTACGT
AGCATCTTCACCGGTTGCCGTGCTGTGATGCTGCCACGATTCGGCGGCCCGGAGGTTTTGGAGCTCCGGGAGAACGTTCC
GGTGCCGAATCTCAATCCGAACGAGGTCCTCGTCCGTGCGAGAGCTGTCTCCGTCAATCCTCTTGATTGCAGAATACGAG
CAGGATATGGGCGTTCTGTGTTACAACCGCATCTACCCGTTATAATTGGACGTGATATCAGTGGTGAAGTTGCAGCCGTT
GGTAACTCAGTGAAGGCATTTAAAGTAGGGCAAGAAGTTTTTGGTGCGTTGCATCCTACTGCATTGAGAGGTACTTATAC
TGATTATGGGATACTTTCTGAGGAGGAACTTACTGAAAAGCCATCATCGGTTTCTCATGTGGAGGCGAGCGCTATTCCTT
TTGCTGCGTTGACGGCTTGGCGTGCGTTGAAGAGTAATGCTCGGATACTCGAAGGACAAAGGCTATTAGTTTTTGGAGGA
GGAGCAGTAGGTTTTGCTGCAATCCAGCTGGGCGTAGCCTTTGGGTGTCATGTTACAGCCTCTTGTGTTGGTCAGACCAA
AGATCGTATACTAGCAGCTGGTGCCGAGCAAGCTGTTGACTACTTAACCGAGGACATTGAGGTGGCAGTGAAAGGAAAGT
TTGACGCTGTGTTGGATACTATTGGTCGGCCTGAGACCGAGAGAATAGGCATAAACTTCTTGAGGAAGGGTGGCAACTAT
ATGACTCTCCAGGGTGAGGCTGCATCATTGACTGATAGATACGGTTTTCTGATTGGGCTTCCGCTTGCAACTTCACTCTT
AGCGAAGAAAAAGATACAGTATCAGTATTCTCATGGAATAGACTACTGGTGGACGTATATGAGGGCTGATCCTGAAGGTC
TAGCCGAGATTCAGCGGTTAGTTGGAGCCGGAAAGCTAAAGATACCAGTGGAAAAGACGTTTCCTATAACCGAAGTTGTA
GCAGCTCATGAAGCCAAGGAGAAGAAGCTGGTTCCGGGTAAGGTGGTTCTAGAGCTCTGA