Details for Kale Locus Bo5g127460

Position : C5 ( 5`- 39553164 .. 39555047 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127460

Protein [Map View]
MAETERPHRSSSINSSSNARNASSTDLFICFTSRFSSSSSMRLSSLSPARSACLTTSLSRRLRPSGSIKNASAGVLNSPM
FGNSGGRKRSGSGYENNNNNNIEPSSPKVTCIGQVRVKTRKHVKKKMRARSRRRGETSSFRRSSSDQNDRGGCRFDASDN
RWVHFPVTICESLRSFGSELNCFSSSSPCRSSCVGGKDGRRGEGNGGGGGSSCFTRWFVAVEETGGKRREIELVVGGGED
EAAEDGRRRSRRRHVFEGLDLSEIEMKTEERRGREDVGMINLCSPPKNALLLMRCRSDPVKVAALANRVRERQMSLDDRV
YGGEEEEDEQRRRFELDLEDKKRIELCEKWISGEREVVSITEPEAPKEEELVHEEEIEAMIIKHIEDDLRNAIEEEDEEQ
TAEMEEEESKEEEEIAAASVTPNVERSNQGNREPDPSPEVIMRGGDQQHDETAEKDKTTPYKVLPDCLLLMMCEPKLSME
VSKETWVCSTDFVRCQPGRPPAKKITEHHHHNHQPKKRIVTGVDSNASSRRRSVDKRPVHHSLLQPPRSSCSYPAAPPLL
TTAASVREQKAAGGNKAYEPPVLPRCKSEPRKSASKLAPEACFWKNRKLEPHPQASVGVGGGAGVGF*

DNA
ATGGCGGAAACTGAAAGACCCCACCGTTCTTCAAGTATTAACAGTAGCAGCAACGCAAGGAACGCTTCTTCAACTGATTT
ATTCATTTGTTTCACATCTCGCTTCTCTTCTTCCTCCTCCATGCGCCTCTCTTCCCTCAGCCCAGCTCGCTCCGCCTGCC
TCACAACTTCTCTCAGCCGACGTCTCCGTCCTAGCGGCAGCATAAAGAACGCTTCGGCCGGAGTCCTAAACTCTCCGATG
TTCGGTAATAGCGGAGGACGTAAGAGATCTGGATCGGGTTACGAAAATAATAATAACAACAACATAGAGCCGTCGTCTCC
GAAGGTGACGTGTATCGGTCAAGTGAGGGTGAAGACAAGGAAGCACGTGAAGAAGAAGATGAGAGCGAGATCTAGGAGGA
GAGGCGAGACGAGCAGCTTCAGGAGATCGTCCTCCGACCAAAACGACAGAGGAGGGTGTCGTTTCGACGCGAGCGATAAC
CGTTGGGTTCATTTCCCCGTGACCATCTGCGAGTCGCTGAGATCGTTCGGCTCCGAGCTTAACTGCTTCTCCTCCTCCTC
GCCGTGTAGATCGTCTTGCGTGGGCGGTAAAGACGGGCGGCGAGGTGAGGGTAACGGCGGCGGAGGAGGCAGCTCGTGCT
TCACGAGGTGGTTTGTGGCGGTGGAGGAGACGGGAGGGAAGAGGAGGGAGATCGAGCTTGTGGTTGGAGGAGGGGAAGAC
GAGGCAGCGGAGGATGGGAGGAGGAGGAGTCGCCGGAGGCATGTTTTCGAGGGGCTTGATTTGAGCGAGATTGAGATGAA
GACGGAGGAGAGGAGAGGGAGGGAGGATGTTGGGATGATTAATCTCTGTTCTCCGCCGAAGAATGCTTTGCTGTTGATGA
GGTGTAGATCTGATCCGGTTAAGGTGGCTGCGTTAGCTAACCGGGTTCGGGAGAGGCAGATGTCGCTTGATGACCGTGTG
TATGGAGGAGAAGAGGAGGAAGATGAGCAGAGGAGAAGGTTTGAGCTTGACTTGGAAGACAAGAAGCGGATCGAGCTGTG
TGAGAAATGGATCTCCGGCGAGAGAGAAGTAGTTTCTATTACAGAACCAGAAGCTCCCAAAGAGGAAGAACTTGTACACG
AGGAAGAGATTGAAGCTATGATCATCAAACACATCGAAGACGATCTAAGAAACGCCATAGAGGAAGAAGACGAGGAGCAA
ACGGCTGAGATGGAAGAAGAAGAAAGTAAAGAGGAGGAAGAGATAGCAGCTGCCTCTGTGACTCCAAACGTGGAAAGATC
CAACCAAGGAAACCGAGAACCCGACCCGAGTCCGGAAGTGATAATGAGAGGAGGAGATCAGCAGCACGATGAAACAGCTG
AGAAAGACAAGACGACGCCGTATAAGGTGTTACCGGATTGTCTGTTGCTAATGATGTGTGAGCCAAAGCTATCGATGGAA
GTCTCAAAGGAGACTTGGGTCTGCTCCACAGACTTCGTTAGATGTCAACCGGGAAGACCTCCGGCGAAGAAGATAACAGA
ACATCATCATCATAACCATCAACCCAAGAAACGAATCGTCACCGGTGTTGACTCCAACGCATCCTCTCGCCGGCGTTCTG
TCGATAAACGACCTGTTCACCATTCGCTGTTACAGCCGCCGAGGTCATCGTGCTCGTACCCAGCAGCTCCGCCGTTATTA
ACGACTGCTGCGTCGGTTAGAGAGCAGAAGGCTGCCGGAGGTAACAAGGCGTACGAGCCGCCAGTGCTGCCACGTTGCAA
GTCGGAGCCGAGGAAGTCAGCTTCGAAGCTTGCGCCGGAAGCTTGTTTCTGGAAAAATCGGAAGCTCGAGCCGCATCCTC
AAGCTTCCGTCGGAGTCGGCGGCGGTGCCGGAGTAGGGTTCTAG