Details for Kale Locus Bo5g127430

Position : C5 ( 5`- 39546677 .. 39548369 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127430

Protein [Map View]
MASALSAFRVSISRISPFRARQFSYPATSGLAHTKRILCSSSHSVSSSPSPSDTYSSSSSLMETNENTRWRPMCLYYTHG
KCTKMDDPAHLEVFNHNCSKELPVTAADLEGKKPQEFDFFLVLDLEGKVEILEFPVLIVDARTMQVVDLFHRFVRPTKMS
EQAINKYIEGKYGEVGVDRVWHDTAIPFKQVVEEFEGWLAEHGLWGKETDGALNDAAFVTCGNWDIKTKIPEQCVVANIN
LPQYFMEWINLKDVYLNFYGREARGMVSMMRQCGIRLMGSHHLGIDDTKNITRVVQRMLADGAVFKITARRSKSNMRNVE
FLFKNRIK*

DNA
ATGGCGTCTGCTCTCTCTGCATTTAGGGTTTCGATATCTAGAATTAGTCCTTTCCGTGCTAGGCAGTTCTCTTATCCCGC
GACTTCCGGTTTAGCCCATACCAAACGAATCTTGTGCAGCTCTTCGCATTCTGTATCTTCGTCTCCTTCTCCGTCTGATA
CTTATTCTTCTTCTTCTTCGTTGATGGAAACAAATGAAAACACGAGGTGGAGACCCATGTGCTTGTATTACACTCACGGG
AAGTGCACAAAGATGGATGATCCTGCCCATTTGGAAGTTTTCAACCATAATTGTTCCAAGGAGCTTCCAGTGACCGCTGC
TGATCTCGAGGGAAAGAAACCACAAGAGTTCGACTTCTTCTTGGTTCTTGACTTGGAAGGAAAAGTTGAGATTCTTGAGT
TTCCTGTTTTGATCGTTGACGCCAGAACCATGCAAGTCGTAGACTTGTTCCACAGGTTTGTGAGACCCACCAAAATGAGC
GAGCAAGCAATTAACAAGTACATCGAAGGCAAGTATGGAGAAGTTGGTGTTGATCGAGTGTGGCATGACACAGCTATTCC
ATTTAAGCAAGTTGTTGAGGAGTTTGAAGGCTGGTTAGCTGAGCATGGCTTGTGGGGTAAAGAAACAGACGGGGCTCTGA
ATGATGCAGCTTTTGTAACCTGTGGAAACTGGGATATAAAGACAAAGATTCCCGAGCAATGCGTAGTGGCAAATATCAAT
CTTCCCCAATATTTCATGGAGTGGATAAATCTCAAAGACGTCTACTTGAACTTCTACGGACGTGAGGCCAGAGGAATGGT
GTCAATGATGAGGCAATGTGGAATAAGGCTCATGGGAAGCCACCATCTAGGCATTGATGACACAAAGAACATCACGAGAG
TGGTGCAACGGATGCTCGCTGACGGTGCAGTATTCAAGATCACAGCACGAAGGAGCAAGTCCAATATGAGAAACGTCGAG
TTTCTGTTCAAGAACCGGATCAAGTAA