Details for Kale Locus Bo5g127420

Position : C5 ( 5`- 39544719 .. 39546322 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127420

Protein [Map View]
MASASSSGGVAGRLRNASLVLVGDNDSTISDIRKAVTLMKNIAVQLEKDNQTEKVKDLENSVAELLDLYGDCAHRSSAIQ
SVANGYQPGEQLTDFKKLLDDEFTKLKAATPSVPENHHLMRQFREAVWNVHHAGEPMPGEDEEDIVMTSTQCPFLNVKCP
VSGKPLTELTDPVRSMDCKHVYDKASIMHYIATNPNAKCPIAGCRGKLKSNKVVCDPMLKFEIEELRTMNKQSNRDEVIE
DFTNADDED*

DNA
ATGGCGTCGGCGTCCTCTTCAGGCGGAGTCGCCGGAAGGCTTCGAAACGCATCGTTGGTTCTCGTAGGCGATAACGATTC
CACAATCTCTGACATACGTAAAGCTGTGACTTTGATGAAGAACATTGCTGTTCAGTTGGAGAAAGATAACCAAACTGAGA
AGGTTAAAGACCTTGAAAATTCTGTGGCTGAGCTGTTGGATTTATATGGTGATTGTGCTCATCGTTCCTCAGCTATTCAA
TCTGTTGCAAATGGGTACCAGCCTGGAGAACAATTAACTGACTTTAAGAAGTTGCTTGACGATGAGTTCACAAAGCTCAA
GGCTGCAACTCCTTCAGTGCCAGAAAATCATCATTTGATGCGCCAGTTCCGGGAAGCAGTTTGGAACGTTCATCATGCAG
GTGAACCAATGCCTGGCGAAGACGAAGAAGACATTGTCATGACCAGTACTCAGTGCCCTTTCCTAAACGTGAAATGCCCT
GTGAGCGGAAAGCCTCTCACTGAACTAACAGATCCAGTTCGCAGTATGGATTGCAAGCACGTGTACGACAAAGCCTCAAT
CATGCATTACATAGCCACCAATCCCAATGCGAAATGTCCCATAGCTGGCTGCCGAGGTAAACTGAAGAGTAACAAAGTGG
TTTGTGATCCAATGCTCAAGTTTGAAATTGAGGAGCTGCGCACTATGAACAAACAATCTAATAGGGATGAAGTGATTGAA
GACTTCACAAATGCAGACGATGAAGATTAG