Details for Kale Locus Bo5g127410

Position : C5 ( 5`- 39540822 .. 39542079 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127410

Protein [Map View]
MKSSSLTSSLRKSLTPTSPVPPFLKLISKPWELPEKAKMGEKEWYFFTRRDRKYPTGLRTNRATEAGYWKATGKDREIKS
SKTNSLLGMKKTLVFYKGRAPKGEKSCWVMHEYRLDGKFSYHYITSSAKDEWVLSKVCLKSSVVSRETKLVSSSSVSVTS
ISCSSSTGSLIAPVIDAFATEHVSCFSNTSASHVDASFPIYLPAPPQSLPRQPRRIDDVAFGQFMGLGSTGQFNIDAAFL
PNLPSLPPTFLHPPPQ*

DNA
ATGAAGAGCTCATCACTTACTTCCTCCTTAAGAAAGTCCTTGACTCCAACTTCTCCTGTGCCGCCATTTCTCAAGTTGAT
TTCAAAGCCTTGGGAGCTTCCAGAGAAAGCGAAGATGGGCGAGAAAGAGTGGTACTTCTTCACACGAAGAGATAGGAAGT
ACCCAACCGGGCTGAGAACGAACAGAGCAACAGAAGCTGGTTACTGGAAGGCAACTGGTAAAGACAGAGAGATCAAAAGC
TCAAAGACAAACTCGCTTCTGGGGATGAAGAAAACTCTCGTCTTTTACAAAGGCAGAGCTCCTAAAGGTGAGAAAAGCTG
TTGGGTCATGCATGAGTATCGCCTCGACGGAAAGTTCTCATACCATTACATTACTTCCTCTGCTAAGGATGAATGGGTTC
TCTCCAAAGTTTGTCTGAAAAGCAGCGTAGTTAGTAGAGAAACGAAGTTGGTCTCTTCTTCTTCCGTTTCCGTCACTAGT
ATTAGTTGCTCCTCTTCCACCGGATCTTTAATTGCTCCGGTTATTGATGCCTTTGCGACTGAGCACGTGTCCTGCTTCTC
CAATACCTCTGCATCGCATGTTGATGCGAGCTTTCCTATATACCTTCCCGCTCCACCACAATCTCTGCCACGTCAACCTC
GCCGCATTGATGACGTGGCGTTTGGTCAGTTTATGGGTCTGGGATCGACTGGACAGTTCAACATCGACGCAGCGTTCTTA
CCGAATCTACCTTCTCTGCCACCGACGTTTCTTCATCCTCCTCCTCAGTAG