Details for Kale Locus Bo5g127370

Position : C5 ( 5`- 39493218 .. 39497995 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127370

Protein [Map View]
MDDVAGLQEAAGARFSQVELIGRGSFGDVYKAFDKELNKEVAIKVIDLEESEDEIEDIQKEISVLSQCRCPYITEYYGSY
LHQTKLWIIMEYMAGGSVADLLQSGHPLDETSIACITRDLLHAVDYLHSEGKIHRDIKAANILLTENGDVKVADFGVSAQ
LTRTISRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITVIEMAKGEPPLADLHPMRVLFIIPRENPPQLDEHFSRPL
KEFVSLCLKKVPAERPSAKELIKHRFIKNAKKSPKLLERIRERPKYQVKEDEETPRNGPKAPFESSGTVRVARDERSQGT
PGSSFQGKTVKNAGWDFSIGASQGIGTVRALKPPHARERRQEVPSNQTSQRTSRAGGSQLSPTSGITVNDHEDGFHDEED
SSVSGSGTVVIRTPKRSQSSSIFREQISASSSGYASLDDASASGTVVVRGQHDDYASPRTPKSRLGNQDRTSSASEDSIA
NLAEAKAALDAGFRRGNARERLGMRNNNKDGNVNRRREQMTEDSDYSRNSGDKSGKQKALPKSQQASDEEEEEEEEEEDP
IWDSLPASLSVLLIPSLKEALGDDSKGSIGRALSRSLVAMERENPGSCEAFVAKLIELLGSSKEASVKELQDMAVRVFSK
TAPADAENKRKPANKEFSSNTNVSPLGRFLLSRWISQSSRDL*

DNA
ATGGACGATGTTGCGGGTTTACAAGAGGCAGCTGGAGCCAGATTTAGCCAGGTTGAGTTAATCGGAAGAGGATCTTTTGG
GGATGTCTATAAAGCGTTTGATAAGGAACTCAACAAAGAAGTTGCAATTAAAGTCATCGACCTGGAAGAATCAGAAGATG
AAATCGAAGATATCCAGAAGGAAATTTCGGTATTGTCACAATGTCGTTGCCCGTATATTACCGAATACTATGGTTCTTAC
CTTCATCAGACCAAACTGTGGATCATCATGGAATATATGGCCGGTGGTTCTGTTGCTGATCTTCTTCAGTCTGGTCATCC
GTTGGATGAAACATCAATCGCTTGTATCACACGTGATCTGCTTCATGCTGTTGATTATCTGCATAGTGAGGGGAAGATCC
ACAGAGACATCAAAGCTGCTAATATTTTATTGACCGAGAATGGCGATGTTAAGGTGGCGGACTTTGGTGTGTCTGCACAA
CTAACACGGACAATATCAAGAAGGAAGACTTTTGTAGGAACACCATTTTGGATGGCACCGGAAGTGATTCAGAACTCAGA
AGGATACAATGAGAAGGCAGATATATGGTCGCTGGGAATAACAGTTATCGAGATGGCAAAAGGAGAACCTCCCCTAGCTG
ACCTTCATCCAATGAGAGTGCTTTTTATCATTCCTCGGGAAAATCCTCCTCAGTTAGATGAGCACTTTTCCCGTCCACTG
AAGGAGTTTGTTTCATTATGCTTGAAAAAAGTCCCTGCTGAGAGACCGAGTGCCAAAGAACTTATTAAACACAGATTTAT
TAAGAATGCTAAGAAAAGCCCGAAACTTCTTGAGAGGATAAGAGAGCGACCAAAGTACCAAGTAAAAGAGGATGAAGAGA
CTCCTCGGAATGGTCCTAAAGCTCCATTTGAATCATCCGGTACTGTTAGAGTGGCTAGAGATGAGAGAAGCCAAGGAACA
CCTGGATCTAGTTTTCAGGGGAAAACTGTCAAAAATGCTGGGTGGGACTTTAGCATTGGGGCCTCTCAGGGTATTGGAAC
AGTTCGTGCTCTAAAACCTCCTCATGCAAGGGAGAGGCGCCAAGAAGTTCCTTCGAATCAGACTTCTCAAAGAACATCAA
GAGCTGGTGGTAGTCAGTTGTCACCCACTTCTGGTATTACAGTTAACGACCATGAAGACGGCTTCCACGATGAGGAAGAT
TCATCGGTCAGTGGATCCGGAACTGTTGTCATAAGAACCCCAAAACGTTCTCAATCATCTTCAATATTCCGTGAACAAAT
CTCTGCATCTAGCAGCGGGTATGCATCTTTGGATGATGCTTCAGCAAGTGGAACTGTTGTTGTCCGTGGACAGCACGATG
ACTATGCGTCACCTCGAACTCCAAAATCAAGGCTAGGGAATCAAGATAGAACTTCGAGTGCCTCAGAAGATAGCATCGCA
AATCTCGCCGAGGCAAAGGCAGCACTTGACGCAGGTTTCAGAAGGGGAAATGCTAGGGAAAGACTTGGGATGAGGAATAA
CAATAAGGATGGGAATGTTAACCGAAGAAGGGAACAGATGACAGAAGATTCTGACTATTCAAGAAATTCTGGCGATAAGT
CTGGTAAACAAAAAGCACTTCCAAAATCACAACAAGCGAGTGATGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGACCCC
ATATGGGATTCATTGCCTGCATCGTTGTCAGTATTGCTCATACCGTCCCTAAAAGAGGCTCTTGGTGACGATTCAAAAGG
ATCCATAGGACGTGCATTGTCGAGATCCCTCGTGGCAATGGAACGTGAAAACCCTGGCTCTTGTGAAGCTTTTGTTGCCA
AGCTGATTGAACTTTTGGGAAGTTCGAAAGAAGCTTCGGTGAAGGAGTTGCAGGACATGGCGGTCCGTGTTTTCTCCAAG
ACAGCGCCCGCTGACGCGGAGAACAAAAGAAAACCAGCTAACAAGGAGTTTAGTTCCAACACAAATGTTAGCCCACTAGG
CAGATTCTTACTCTCAAGATGGATAAGCCAATCATCTCGTGATCTTTAA