Details for Kale Locus Bo5g127310

Position : C5 ( 5`- 39460884 .. 39461495 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127310

Protein [Map View]
MEGQRSQRWGYLKDKAIATSLAEEEMENSMDGEEDDTGDEDKRKRVMERARGPNTERVPLRLCLVDRCTANLTEAKQYYR
RHKVCEVHAKASSATVAGVKQRFCQQCSRFHELAEFDETKRSCRRRLAGHNERRRKISGDSYGEGSGRRGVSLTQTQERN
RIDMKLPMTNSPFKRPQIR*

DNA
ATGGAGGGTCAGAGATCACAACGCTGGGGTTACTTGAAAGACAAGGCTATAGCCACCAGCCTTGCTGAAGAAGAAATGGA
AAATAGCATGGATGGAGAGGAGGATGATACTGGAGATGAAGACAAAAGGAAGAGAGTGATGGAGAGAGCTAGAGGTCCTA
ACACAGAACGTGTTCCCTTGCGGCTGTGCCTGGTCGATAGGTGCACTGCTAACTTAACTGAGGCCAAGCAGTATTACCGC
AGACACAAAGTCTGTGAGGTTCATGCAAAGGCATCTTCTGCAACTGTTGCTGGAGTCAAGCAACGTTTTTGTCAACAATG
CAGCAGGTTCCATGAGCTAGCAGAGTTTGATGAAACTAAAAGAAGTTGCAGGAGGCGCTTAGCTGGACACAATGAGAGGA
GGCGGAAGATATCTGGTGACAGTTACGGAGAAGGGTCAGGCCGGAGAGGGGTTAGCTTGACACAGACTCAAGAAAGAAAC
AGGATAGACATGAAACTTCCTATGACTAACTCACCATTCAAGCGACCACAGATCAGATAA