Details for Kale Locus Bo5g127300

Position : C5 ( 5`- 39457567 .. 39458159 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127300

Protein [Map View]
MPIRLSIKRLVTVTISKTHGGDVSGYVLRHATTRFDRLFTAFRQTESMRDRHDDRSTASYVSDKAKEGVTKATDAALNAG
DNMKDAMDGAWKAAKETGQNISEAVAGDDDTGDRIQEDKVAVELKDVSQPVDTTEYRGVEELHQQTDGENKSP*

DNA
ATGCCGATTAGGTTGTCGATTAAGAGACTCGTGACGGTGACCATTTCAAAAACTCATGGCGGAGATGTCTCCGGTTATGT
CCTCCGACACGCTACCACCCGGTTCGACCGCCTCTTCACCGCATTTAGGCAAACCGAGAGCATGAGAGACCGTCACGACG
ATAGGTCCACAGCGAGTTACGTGTCAGATAAGGCAAAGGAAGGGGTGACAAAAGCGACGGATGCAGCCTTGAACGCAGGA
GATAACATGAAGGATGCGATGGACGGGGCCTGGAAAGCTGCCAAGGAAACGGGTCAGAACATCAGCGAAGCCGTTGCCGG
AGATGATGACACCGGCGATAGGATTCAAGAGGACAAGGTCGCGGTGGAGTTGAAGGATGTTAGCCAGCCTGTTGATACGA
CGGAGTATAGGGGTGTGGAGGAACTACATCAGCAAACCGACGGTGAAAATAAATCACCGTGA