Details for Kale Locus Bo5g127270

Position : C5 ( 5`- 39452237 .. 39452914 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127270

Protein [Map View]
METTTKPNPSSTTSSSASSSIINGSLHHHIITRSDHYPTTFVQADTSTFKQVVQMLTGTSSPRSPDSPRPPPSPSGKSTF
VIPPVKTTQPKKHSGNKLYERRSNNSSLKNSLMINTLMIGGGNGAGSPRFSPRNQEILSPSCLDFPKLALNSPVTPLKHG
GDGNDGDPFDRMSPLSEEERAISEKGYYLHRSPISTPRESEPQLLPLFPVTSPRVSAASPDYSTS*

DNA
ATGGAGACCACAACGAAACCAAACCCATCTTCCACTACTTCATCATCAGCTTCCTCTTCCATTATCAATGGATCTCTACA
TCACCACATCATCACCAGATCTGATCATTACCCAACAACTTTCGTTCAAGCAGACACTTCCACTTTCAAACAAGTCGTCC
AGATGCTAACCGGCACCTCCTCCCCGAGATCCCCAGACTCGCCGCGTCCTCCTCCGTCTCCTTCCGGCAAGAGTACTTTC
GTTATTCCACCGGTCAAAACGACGCAGCCGAAGAAACACTCGGGAAACAAACTCTACGAGAGGAGATCGAACAACAGCAG
CCTCAAGAACAGCCTCATGATTAACACACTCATGATCGGCGGCGGAAACGGTGCCGGAAGCCCAAGATTCTCGCCGAGAA
ACCAGGAGATTCTGTCGCCTAGCTGTCTTGACTTCCCGAAGCTAGCACTGAACAGCCCCGTGACGCCGCTGAAACACGGT
GGCGACGGGAACGACGGTGACCCTTTCGACAGGATGTCGCCATTGTCGGAGGAAGAGAGAGCGATCTCGGAGAAAGGTTA
TTACTTGCATAGGTCGCCTATTTCAACTCCGAGGGAATCGGAGCCGCAGCTTTTGCCGCTGTTTCCTGTTACTTCTCCGA
GAGTATCGGCTGCTTCACCGGATTATTCAACTTCTTGA