Details for Kale Locus Bo5g127260

Position : C5 ( 5`- 39442546 .. 39444764 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127260

Protein [Map View]
MGAQIIYCDGFEVVPPPPEMNDLILIGSDQSGGGGSNCGESTVTTEEEGTVFSGDSSPGWRETKLFSFYFVKQPAYDDLD
IKSKISKADSEIYHWNKRRIDVYSAQKYQRAELSSLYAQMESLVARSQGRKVVLEDKKMEFDSLQEGLRCSSSDELDHLI
FTAHYVVEHGSVKEEDWMLQETEKPGGMTLSDDSLAQKEASIHSLKLMAVEMNEVKKELEAIAWNIQQLSDKIGQIQNKV
MVLDAEMSYILEQRDKSYEKIKMLRIQRDKGNAAFYHSIAVMKRAKELAASGNVRDLEVYSSSEVDRFMARWNNDKAYRE
DYVKRISHSLCERQLSRDGRIRDPESEAQAVREKLLKTRKEGMAVHKMNREDSSSNSSQDGNVITEKQKKEVRKKAMDFS
RSSAEESDVIDLEFPVYENPKKEGEVDEETLKERKREEQLEKAQLAMERKRKLQEKATAKAAIRAQKEAEKKLKECEKKA
KKKAASNSSLVKSQEAINELEKVSTIAVSGKEKQRSMFPKRSFRYKHRARGTEALPKAILNRRKAQRYWVWGLSSAALAL
VLFLVFLLLR*

DNA
ATGGGTGCGCAAATTATATACTGTGATGGCTTCGAGGTGGTTCCTCCTCCCCCGGAGATGAACGACCTAATACTCATCGG
AAGCGACCAATCCGGCGGCGGCGGCTCAAACTGCGGCGAATCGACCGTAACCACCGAAGAAGAAGGTACTGTTTTCTCCG
GCGATAGTTCACCGGGATGGCGTGAAACCAAGCTTTTCTCTTTCTACTTCGTCAAGCAACCGGCTTACGATGATCTCGAC
ATCAAATCCAAAATCAGTAAAGCTGATTCAGAGATTTATCACTGGAATAAACGGAGAATTGATGTCTACAGTGCTCAGAA
ATACCAAAGGGCTGAGTTGTCGTCTTTGTATGCTCAAATGGAGAGTTTGGTTGCTAGATCGCAAGGACGTAAAGTGGTTT
TGGAAGATAAGAAGATGGAGTTTGATTCTCTGCAGGAAGGTCTACGGTGCTCTAGCAGTGATGAACTTGACCATCTTATC
TTCACAGCACATTACGTGGTTGAACATGGAAGTGTGAAGGAAGAAGATTGGATGCTTCAAGAGACCGAGAAGCCTGGTGG
GATGACTCTAAGTGATGACTCTCTTGCGCAGAAAGAAGCTTCCATACACAGTCTCAAGTTAATGGCTGTGGAAATGAATG
AAGTAAAGAAGGAGCTTGAAGCTATTGCATGGAACATTCAGCAGTTGAGTGACAAAATAGGACAGATTCAGAACAAGGTC
ATGGTTCTTGATGCAGAAATGTCATACATACTTGAGCAGAGAGACAAATCATATGAAAAGATTAAGATGCTGAGGATACA
GCGAGACAAAGGGAACGCTGCGTTTTACCACAGCATTGCTGTTATGAAGAGAGCCAAAGAACTGGCTGCTTCTGGAAACG
TTAGAGACCTTGAAGTGTACTCTAGCTCTGAGGTTGATAGGTTCATGGCTCGTTGGAACAATGACAAGGCTTATAGAGAG
GACTACGTGAAAAGAATCTCGCATTCACTCTGTGAAAGACAGCTGAGCCGAGATGGGAGGATTAGAGATCCTGAAAGTGA
AGCTCAGGCTGTTCGGGAGAAGCTGCTTAAGACTAGAAAGGAAGGTATGGCGGTTCACAAGATGAACAGAGAAGACTCCA
GCTCAAACTCGTCTCAAGATGGGAATGTAATCACTGAAAAGCAAAAGAAAGAAGTGAGGAAGAAGGCGATGGATTTCAGC
AGGTCAAGTGCTGAGGAGAGTGATGTTATAGACTTGGAGTTCCCGGTGTATGAGAATCCGAAAAAAGAAGGAGAGGTTGA
TGAAGAAACGTTGAAGGAAAGGAAACGTGAAGAGCAGCTAGAGAAAGCTCAGTTAGCTATGGAAAGGAAGAGGAAGCTAC
AAGAGAAAGCAACTGCTAAAGCTGCTATAAGAGCTCAAAAGGAAGCTGAAAAGAAACTCAAGGAGTGTGAGAAGAAAGCG
AAGAAGAAAGCTGCATCAAACTCTTCTCTTGTCAAATCACAAGAAGCAATCAATGAGCTTGAAAAGGTGAGTACTATAGC
AGTCTCAGGGAAAGAGAAGCAGAGATCAATGTTTCCAAAGAGGAGTTTCAGGTACAAACACCGTGCAAGAGGAACCGAAG
CTCTTCCTAAAGCTATCCTAAACCGTAGAAAGGCTCAGAGGTATTGGGTTTGGGGACTCTCCTCTGCTGCACTTGCTCTA
GTGCTCTTCCTTGTGTTTTTACTATTACGGTGA