Details for Kale Locus Bo5g127250

Position : C5 ( 5`- 39427997 .. 39430911 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127250

Protein [Map View]
MEDSSNSNSRGFLNTSGVSDRNTEFSPLERVTPRSKPLSVFGSSAHKSSEEDSLGIDDPFVRSLEWGDVSLRQWLDKPER
CVDVFECLHVFRQIVEIVNVAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSADSLEDGPVSHKKREDAGSYNNI
LERQVEKLEEEKKQPFPMKHVLAMETSWYTSPEEEFGSTSTCASDVYRLGVLLFELFCPVPSREDKSRTMSSLRHRVLPP
QILLKCPKEASFCLWLLHPEPSCRPSMSDLLQSEFMTEPRDNLEEREAAIELRDKIEEQESLLEFLLMIQQRKQESAYRL
RDTVSLLSSDIEQVAKRQLVLKQKGSSYSDLGFLEEPSTLLASRKRFRQVIPPEETDDEESQGRSTFLESSRLMRNFKKL
ETVYFLTRRRQLKAAASGKSLTRHSPLSSENGRGSEKSSVSNSAAPKDLSQNDSRQGGWIDPFLEGLCKYLSFSKLRVKA
DLKQGDLLNSSNLVCSLAFDRDGEFFATAGVNKKIKIFECDSIVNNNQDIHYPVVELASRSKLSSVCWNSYIKSQIASSN
FEGVVQIWDVGRSQLVTEMKEHKKRVWSINISSADPTLLASGSDDGTVKLWSINQGASIGTIKTKANVCCVQFPSDSGRS
LAFGSADHKVYYYDLRNPKIPLSTMVGHGKTVSYVKFVDSSTLVSSSTDNTLKLWDLSMSASGVNETPLHSFAGHTNLKN
FVGLSVSDGYIATGSETNEVFVYHKAFPMPVMSYMFSNTDSTSGLEVDDASQFISSICWRGLSSTLVAANSNGNIKILEM
VA*

DNA
ATGGAAGACTCTTCAAACTCCAACTCTAGAGGGTTCCTCAATACCTCTGGCGTTTCAGACAGGAACACTGAGTTCTCACC
GCTCGAGAGAGTCACACCTCGTTCGAAACCGTTAAGCGTGTTTGGTAGCAGCGCACACAAATCCAGCGAAGAAGATTCTT
TAGGGATTGATGACCCTTTTGTTAGATCCTTGGAATGGGGCGATGTCAGCTTGAGACAGTGGCTGGACAAGCCTGAACGG
TGCGTAGACGTTTTCGAGTGCTTGCACGTTTTCAGACAAATCGTGGAGATTGTGAATGTGGCTCACTCTCAAGGCATTGT
TGTTCATAACGTTAGACCTTCTTGCTTTGTCATGTCTTCGTTTAACCATGTTTCATTCATTGAGTCCGCTTCTTGCTCCG
ACTCGGGGTCTGCTGATTCCTTGGAGGACGGTCCAGTTAGCCATAAGAAAAGAGAGGACGCTGGATCCTATAACAATATC
TTGGAGAGGCAAGTAGAGAAGCTAGAGGAAGAGAAGAAGCAACCGTTTCCGATGAAACATGTGTTAGCGATGGAGACGAG
TTGGTATACAAGCCCTGAAGAGGAGTTTGGTTCTACGAGTACTTGTGCTTCAGATGTCTACCGTCTTGGTGTTCTTCTTT
TCGAGCTGTTCTGTCCTGTGCCTTCAAGAGAAGACAAGTCAAGAACCATGTCTAGTTTAAGACATCGTGTGCTTCCGCCT
CAGATACTGCTCAAATGTCCTAAAGAAGCTTCTTTCTGCTTGTGGCTCTTGCATCCAGAGCCAAGCTGTCGACCATCAAT
GAGTGACTTGCTGCAAAGCGAGTTTATGACCGAACCAAGAGATAATCTGGAAGAACGTGAAGCAGCAATAGAGCTTAGGG
ACAAAATCGAGGAACAGGAGTCGTTACTCGAGTTCTTGTTGATGATTCAACAGAGAAAGCAGGAGTCTGCTTATAGATTG
AGGGATACAGTTTCACTTCTTTCTTCAGACATCGAGCAAGTTGCGAAGAGACAGTTAGTTTTGAAGCAAAAGGGAAGCTC
ATACTCTGATCTCGGCTTCCTGGAAGAGCCTTCAACATTATTGGCTTCAAGAAAACGGTTTAGACAAGTGATTCCCCCAG
AGGAAACGGACGACGAGGAGAGTCAAGGAAGAAGCACGTTTCTTGAAAGCTCCAGGTTGATGAGAAACTTCAAGAAGCTA
GAAACCGTCTACTTTCTGACAAGGCGCAGGCAACTCAAAGCTGCTGCTTCGGGGAAGTCATTAACTAGACATTCACCGTT
AAGCAGCGAAAACGGAAGAGGTTCGGAGAAAAGCTCAGTAAGCAACTCTGCAGCACCGAAAGATCTTTCCCAAAATGATT
CAAGACAAGGAGGGTGGATAGACCCTTTCCTTGAGGGTTTGTGCAAATACTTATCATTCAGTAAGCTCAGAGTGAAAGCA
GATCTAAAACAAGGAGACTTGTTGAACTCTAGTAACCTTGTTTGCTCCCTTGCGTTTGACCGAGATGGAGAGTTTTTCGC
TACTGCTGGTGTCAACAAGAAGATCAAGATCTTTGAATGTGATTCCATTGTTAACAATAACCAGGACATTCACTATCCGG
TTGTGGAGTTGGCTAGCCGGTCAAAGCTGAGTAGTGTATGCTGGAACAGCTACATAAAGAGTCAGATTGCATCAAGTAAC
TTTGAAGGCGTTGTTCAGATATGGGATGTTGGAAGAAGCCAGTTGGTTACAGAGATGAAGGAGCACAAGAAGAGAGTGTG
GTCCATCAATATTTCATCAGCAGACCCGACTTTGCTAGCTAGTGGAAGCGATGATGGAACCGTTAAGCTATGGAGTATCA
ATCAGGGAGCTAGCATTGGAACCATCAAGACAAAGGCCAATGTATGTTGTGTCCAGTTTCCATCAGACTCGGGGCGGTCT
TTAGCATTCGGCTCTGCAGATCACAAAGTGTATTACTACGATCTTAGGAATCCCAAGATTCCTCTTAGCACAATGGTTGG
TCATGGTAAGACAGTGAGTTATGTCAAGTTTGTGGATTCGTCTACTCTTGTGTCTTCTTCTACTGATAACACGCTGAAGC
TTTGGGACTTATCCATGTCTGCCTCTGGTGTTAACGAAACGCCTCTTCATTCATTTGCTGGACACACTAATCTAAAGAAC
TTTGTTGGCTTATCGGTCTCTGATGGGTATATAGCTACAGGCTCAGAGACTAACGAGGTTTTCGTGTACCACAAGGCATT
CCCAATGCCGGTGATGTCGTACATGTTCAGCAACACTGACTCTACATCTGGTCTAGAAGTTGATGATGCCTCACAGTTCA
TATCTTCCATCTGCTGGCGAGGACTGTCGTCTACCTTAGTCGCTGCTAACTCCAATGGCAACATCAAGATTCTGGAAATG
GTGGCGTGA