Details for Kale Locus Bo5g127210

Position : C5 ( 5`- 39413734 .. 39414144 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127210

Protein [Map View]
MSSCGNCDCADKTQCVKKGTSYTFDIVETQESYKEAMIMDVNGAEENGCQCKCGSSCSCVNCTCCPN*

DNA
ATGTCTTCGTGCGGAAACTGCGACTGTGCTGACAAGACCCAGTGCGTGAAGAAGGGAACCAGCTACACCTTCGACATCGT
CGAGACTCAGGAGAGCTACAAGGAAGCCATGATCATGGACGTTAATGGTGCAGAAGAGAACGGGTGCCAATGCAAGTGTG
GCTCTAGCTGCAGCTGCGTCAACTGCACTTGCTGCCCCAATTAA