Details for Kale Locus Bo5g127190

Position : C5 ( 5`- 39404245 .. 39406819 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127190

Protein [Map View]
MEPEIAHPVASCSITLTPNKAPTSYVNGVEEQYEMQNGGGVDNKNKGKAIRLESQSDDEQPEGSASDCYDPGSSPLSDSL
LDPDSLVYEDDDDYSDHYGYGIEDEIEDDHADDYVSEYQALFDAKEKEIPAGVEVAMDWLPSSETAKPSGSSSSSKKATT
GSGIYLTPNNAYALPQKIHGFHYSGPALKYSSTHLGPKTDPGTVMGEAPVPAPASSGLSLQMSKKNPGYLGFASTRPHVE
EVISAPNTYTVKRNVEDYLGKYLFFKKFDIVEDLVDHHYAAKGTTSKQHSKEWAKRIQEEWKILENDLPEQTIFVRAYES
RMDLLRAVIVGADGTPYHDGLFFFDIFFPDTYPSGPPMVHYHSGGLRINPNLYNSGKVCLSLLGTWSGVQTEKWIPNEST
MLQVLVSIQGLILNQKPFFNEPGYERMAGSLSGECQSNAYSEKIFLLSLKTMVYNMRRPPKYFEDFAYGHFLSSAHDVLK
ACNAYRNGAPVASLVRGNVKGGEESSERCSESFKKDVGAFVDTLLLKEFILLGVLGLEPEKEED*

DNA
ATGGAGCCCGAGATCGCTCATCCTGTTGCTTCATGCTCGATAACTCTAACGCCGAACAAGGCACCAACTTCATATGTTAA
TGGTGTGGAGGAGCAATATGAAATGCAAAACGGTGGTGGTGTTGATAATAAGAATAAAGGGAAGGCTATACGATTGGAAT
CACAATCTGACGATGAGCAGCCTGAGGGATCTGCTAGCGATTGTTATGATCCTGGATCCTCTCCACTGTCAGATAGTTTG
CTAGACCCTGACTCTTTGGTATACGAAGACGACGATGACTATTCTGATCATTATGGCTATGGGATAGAGGATGAGATCGA
GGATGATCATGCAGATGACTACGTCTCCGAGTATCAAGCCCTTTTTGATGCCAAGGAGAAGGAAATCCCAGCTGGTGTGG
AGGTGGCCATGGATTGGCTTCCAAGTTCGGAAACTGCTAAACCAAGTGGAAGCAGCAGCAGCTCCAAGAAAGCAACAACA
GGAAGTGGAATCTATTTAACTCCAAACAATGCTTACGCATTGCCACAAAAAATCCATGGTTTCCATTACTCTGGACCAGC
TTTGAAGTATTCTTCCACTCATCTTGGGCCTAAGACTGATCCTGGCACCGTGATGGGAGAGGCCCCGGTTCCGGCTCCAG
CTTCTTCTGGTTTATCGCTTCAGATGTCCAAAAAAAATCCAGGATATTTGGGTTTTGCTAGCACTCGGCCTCACGTGGAA
GAGGTTATCTCAGCTCCAAATACTTACACAGTTAAGAGAAACGTGGAGGATTATCTTGGCAAGTACTTGTTTTTCAAGAA
GTTTGACATCGTTGAAGATCTTGTGGACCACCATTATGCTGCCAAGGGAACAACTTCCAAACAGCATTCCAAGGAATGGG
CCAAAAGGATCCAAGAAGAGTGGAAAATTCTTGAGAATGATTTGCCAGAGCAGACGATATTTGTGAGAGCGTATGAGTCG
AGGATGGATCTTTTGAGGGCTGTAATTGTTGGAGCCGATGGAACTCCCTATCATGACGGTCTCTTCTTTTTCGATATCTT
CTTCCCTGATACATACCCTTCTGGCCCACCGATGGTTCATTACCACTCTGGTGGGCTAAGAATCAACCCGAATCTGTACA
ATAGTGGGAAAGTGTGTCTGAGTCTTCTCGGGACTTGGAGTGGTGTCCAGACGGAGAAGTGGATCCCCAATGAGTCTACA
ATGCTGCAGGTTCTTGTCTCAATCCAAGGACTAATCTTGAACCAAAAACCTTTTTTCAACGAACCTGGGTACGAGAGAAT
GGCTGGTTCTCTATCCGGGGAGTGCCAATCTAACGCTTACAGCGAGAAGATATTCTTACTTTCTCTCAAGACGATGGTTT
ACAACATGAGGAGACCACCCAAGTATTTTGAAGACTTCGCGTATGGGCATTTCCTCAGCTCTGCTCACGACGTGTTGAAA
GCATGTAATGCTTATAGAAACGGAGCTCCAGTGGCGTCTTTGGTGAGGGGAAATGTTAAAGGAGGGGAAGAGAGTAGCGA
GAGATGCTCCGAGTCGTTCAAGAAAGATGTGGGTGCCTTCGTGGACACGCTTTTGTTGAAGGAGTTCATTCTTCTAGGCG
TCCTTGGTCTCGAACCAGAAAAAGAAGAAGACTAA