Details for Kale Locus Bo5g127180

Position : C5 ( 5`- 39403336 .. 39403755 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127180

Protein [Map View]
MASASSSAARLLIRDGKSVASLLFRGRAAANLTENTGSAIRSLLLLNQTVVPSQYPVFSETFPVMQPGLGSCFIQEEAVS
ERRGKMEAGQGKRVVNNEGSSSSSEEETDFDIDMDDDEEFDDTDEEEDEEDEQIVKKKK*

DNA
ATGGCTTCAGCTTCATCATCGGCCGCGAGGTTACTCATCCGCGACGGGAAATCAGTGGCGAGTTTACTCTTCCGTGGACG
TGCAGCAGCCAATCTCACGGAGAACACTGGATCGGCCATTCGGTCTCTGCTTCTGTTAAACCAGACGGTGGTGCCTAGTC
AATACCCGGTTTTCTCTGAAACATTTCCGGTTATGCAACCCGGTTTGGGTTCCTGCTTCATTCAGGAGGAGGCTGTGTCG
GAGAGAAGAGGGAAAATGGAAGCGGGTCAGGGAAAGCGAGTGGTGAACAACGAGGGCAGCTCTTCTTCTTCGGAGGAGGA
GACAGATTTTGATATTGATATGGACGATGATGAAGAGTTTGACGATACTGACGAAGAAGAAGATGAGGAGGACGAGCAGA
TAGTGAAGAAGAAGAAGTAA