Details for Kale Locus Bo5g127170

Position : C5 ( 5`- 39401468 .. 39402515 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127170

Protein [Map View]
MASLLDSVTVTRVFSLPITSSISPASKVPSVSARRISPVPEFRGLKASRKSSVTQSASLGTNLGSRFARGGRIVCEAQDT
TAAPVEVPNISDSEWQTQVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYSIRSVPT
VIIFKDGEKKDSIIGAVPKETLEKTIERFVVE*

DNA
ATGGCTTCCTTGCTCGATTCCGTCACCGTTACCCGCGTGTTTTCCCTTCCGATCACTTCCTCGATTTCACCTGCTTCAAA
GGTTCCGTCAGTCTCTGCCCGGCGGATTTCTCCCGTTCCGGAATTCAGAGGTTTGAAAGCTTCCCGGAAGAGTTCGGTGA
CTCAGTCAGCGAGTCTTGGTACGAATCTCGGATCCCGATTCGCTCGTGGTGGAAGAATCGTCTGCGAGGCTCAGGACACC
ACTGCCGCCCCCGTCGAAGTACCAAACATCTCTGATTCAGAATGGCAAACACAGGTTCTCGAGTCAGATGTACCAGTATT
GGTCGAGTTTTGGGCACCATGGTGTGGACCTTGCCGTATGATTCACCCCATCGTTGACCAACTGGCCAAGGACTTCGCAG
GCAAGTTCAAATTCTACAAAATCAACACCGACGAGAGCCCAAACACAGCTAACCGTTACAGCATCCGCAGCGTTCCTACC
GTGATCATATTCAAAGACGGTGAGAAGAAAGACAGTATCATTGGAGCTGTTCCTAAAGAGACGTTGGAGAAAACTATAGA
AAGATTCGTGGTCGAGTAA