Details for Kale Locus Bo5g127160

Position : C5 ( 5`- 39399195 .. 39400275 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127160

Protein [Map View]
MEMKGKYLVTVILLVGTLSVGMCSNGWIRAHATYYGVNDSPASLGGACGYDNPYHAGFGAHTAALSGALFRNGESCGGCY
QVRCDYWADPKWCLRGAAVTVTATNFCPSNNNGGWCNLPRHHFDMSMPAFFRIARRGNEGIVPVFYRRVGCKRRGGVRFT
MRGQGNFNMVILSNVGGSGAVKAVAVRGSRGKTWRQMTRNWGANWQSSGDLRGQRLSFRVTLLDRKTMTFLNVVPSSWWF
GQTFSGRGQFL*

DNA
ATGGAAATGAAGGGAAAATATTTGGTTACGGTTATTTTATTGGTTGGTACGTTAAGTGTGGGGATGTGTTCCAATGGTTG
GATTAGGGCGCATGCAACGTATTATGGTGTTAATGATAGCCCTGCTTCACTTGGAGGAGCTTGTGGGTATGACAATCCAT
ACCACGCTGGATTCGGAGCCCATACAGCGGCGCTAAGCGGTGCGCTATTCAGAAACGGCGAGTCGTGCGGTGGTTGCTAC
CAAGTGAGGTGCGACTATTGGGCGGATCCTAAGTGGTGTCTCCGAGGAGCCGCTGTGACGGTGACGGCTACAAACTTCTG
TCCGTCGAACAACAATGGAGGTTGGTGCAATCTCCCTCGCCACCACTTTGACATGTCCATGCCCGCTTTCTTCCGCATAG
CTCGCCGCGGCAACGAAGGCATCGTCCCCGTCTTCTACCGCCGAGTTGGGTGCAAGAGAAGAGGAGGTGTGAGGTTCACG
ATGAGAGGTCAAGGGAACTTCAACATGGTAATACTCTCAAACGTTGGCGGCAGTGGCGCGGTGAAAGCGGTTGCGGTGAG
AGGATCAAGGGGAAAGACTTGGCGTCAGATGACTCGTAACTGGGGTGCCAACTGGCAGAGCTCCGGTGATCTCCGTGGAC
AGAGACTCTCCTTCAGAGTTACTCTTCTTGACCGCAAGACGATGACGTTTCTAAACGTTGTTCCTTCTTCTTGGTGGTTC
GGCCAAACCTTCTCTGGTCGAGGCCAGTTCCTCTGA