Details for Kale Locus Bo5g127150

Position : C5 ( 5`- 39391874 .. 39394794 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127150

Protein [Map View]
MSMLGSSSHSDPDSRSLQVLLDAFGSRFSLDDIAAAYCQASQNVHEAGEILFAMTTKEAPQSDQVKTNGATSKPTHVYVP
KKVQTQENDSNAAKVWRPKKSSVSVGTVSSVIGKEYARRSMPESNARQEAVKPMKIDARDIPETEIWREDELPRSNEGNV
SRAPTDVEEFIAKMLGEGFQASPEVIQQILGVCGYDVMKSTEKLLDLSDTKKHADVGISNEITSKVDPQSSGEARTLTGS
QEGGKNNSGLEKEVLEALFSGVERYEEVPKVTRRFGERRARVAGPLVFEPLEDTFQERVVTMIQSTNTSKEDEDDENEYK
AHRKAVHENLQEMKEYYGAAVEAFSKGETERARRLVEKGHFFGQKAREADDKSVAKMLELKEDDGSAYKEDEVVTVNVNE
HEPREALRLLKLQLRNFSGIPSIKYLRVKLGDNKEDSKCKRRLTAIAKLLAGDSIAWSEEDNGLVMMIRVDEVIPEKLSF
AKK*

DNA
ATGTCAATGCTTGGAAGCTCTTCCCACAGTGATCCAGATTCGAGAAGCCTGCAAGTGCTTCTCGATGCTTTCGGTTCTCG
TTTCTCTCTCGACGACATTGCTGCTGCCTACTGCCAAGCTAGCCAAAACGTCCATGAAGCTGGTGAGATCCTCTTCGCCA
TGACGACGAAAGAAGCGCCTCAAAGTGACCAAGTGAAAACGAATGGAGCAACCTCAAAGCCAACCCATGTCTATGTTCCC
AAGAAAGTTCAAACACAAGAGAATGATAGCAACGCCGCCAAAGTATGGAGGCCGAAGAAAAGTTCTGTATCAGTTGGTAC
TGTTTCAAGTGTTATTGGAAAGGAGTATGCTAGAAGAAGCATGCCTGAATCAAATGCTCGCCAAGAAGCAGTTAAACCGA
TGAAGATAGACGCAAGGGATATTCCTGAAACTGAGATATGGAGGGAAGACGAATTGCCAAGAAGCAATGAGGGAAACGTA
AGCAGAGCACCAACTGATGTTGAGGAGTTTATTGCTAAGATGCTTGGAGAAGGCTTTCAAGCTAGCCCAGAGGTCATTCA
ACAGATTCTCGGCGTATGCGGATATGATGTGATGAAGAGTACGGAGAAACTGCTCGACTTGTCTGATACCAAGAAGCATG
CTGATGTTGGAATCTCTAATGAAATTACTTCAAAAGTTGATCCTCAGAGCAGTGGTGAAGCAAGAACCCTAACAGGTTCA
CAGGAAGGAGGCAAGAACAATAGTGGTCTTGAAAAGGAAGTCTTAGAAGCTTTGTTCTCTGGTGTTGAAAGATATGAGGA
AGTGCCAAAAGTAACTAGACGATTTGGAGAAAGGAGAGCAAGAGTTGCCGGCCCTCTTGTTTTTGAACCTCTGGAAGACA
CTTTTCAAGAGAGAGTTGTTACTATGATACAATCAACAAATACATCTAAAGAAGATGAAGATGATGAAAATGAATACAAG
GCACATCGTAAAGCAGTGCACGAGAATTTGCAGGAGATGAAAGAATACTACGGAGCTGCTGTAGAAGCATTCTCCAAAGG
AGAAACCGAGCGAGCACGCAGACTCGTGGAGAAGGGACACTTTTTCGGACAAAAAGCTAGGGAGGCAGATGACAAATCCG
TAGCAAAGATGCTTGAACTCAAGGAAGACGATGGTTCGGCTTACAAGGAAGACGAGGTGGTGACAGTAAATGTGAATGAA
CATGAACCAAGGGAAGCTCTTCGTCTTCTCAAGCTCCAACTTAGGAACTTCTCTGGCATTCCATCTATTAAGTACCTCAG
AGTCAAATTGGGTGACAACAAGGAAGACTCCAAATGCAAACGAAGGCTTACGGCAATTGCCAAGTTGCTGGCGGGAGATT
CCATTGCTTGGTCTGAAGAAGATAATGGCCTCGTGATGATGATTCGCGTTGATGAGGTTATCCCTGAGAAGTTGAGTTTT
GCCAAGAAATAA