Details for Kale Locus Bo5g127140

Position : C5 ( 5`- 39389477 .. 39389728 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127140

Protein [Map View]
MMGSRGIISDKWSMRILWGCALGSAVGLYMVAVERQTQNRARALAEGLRAAESQAGDA*

DNA
ATGATGGGGTCGAGAGGAATAATCAGCGATAAGTGGTCAATGAGGATTCTCTGGGGCTGTGCACTCGGAAGTGCAGTTGG
TTTATACATGGTTGCTGTAGAAAGACAAACCCAGAACAGAGCACGTGCTTTGGCTGAAGGTTTGAGAGCTGCTGAATCAC
AAGCTGGTGATGCCTGA