Details for Kale Locus Bo5g127130

Position : C5 ( 5`- 39387383 .. 39389103 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127130

Protein [Map View]
MAKGHQGRCFGFVLLLCFFSSTLARRVLKDLSMMEARKLEMNHVVKPGMSMPGKPEEPEDKIMPDRKMQSMPGEPEEPED
KIMPDRKMQSMPGEPEEPEDKIMPDRKMQSMPGEPEEPEDKIMPDRKMQSMPGEPEEPEDKIMPDRKMQSMPGEPEEPED
KIMPDRKMQSMPGEPEEPEDKIMPDHMLRSMPGEPEEPEDKIMPDHRLRSMPGAPEEPEDKVMPDHELQPMWGELEEPDP
KTMLDHKEKPDHKVQSLASEPEDPDQTVKPMGYGEGRGYGSGGGYGEGIGSSGGSGYGEGIGSSGGSGYGEGRGSGSGQP
NCGPVFGAPGSGYGEGIGQGSGSGEGIGIGIGGGSSGSVPSVVVPSISIPPITVPGTQIPGFVIPGVRVNPGYGSGGCQT
GGCTPSVPYYRPPIYQQPPSCSHCAPFVSGQDKHMSDKGTVAEEALAPTSNEMLV*

DNA
ATGGCAAAGGGACACCAAGGCAGATGCTTTGGATTCGTTCTCTTACTATGCTTCTTTAGTTCAACTTTGGCACGCAGGGT
TCTCAAGGATCTCTCAATGATGGAGGCAAGAAAGCTAGAGATGAACCATGTTGTGAAGCCTGGGATGTCCATGCCGGGTA
AACCGGAAGAGCCTGAGGACAAGATCATGCCTGATCGCAAAATGCAATCCATGCCAGGTGAACCAGAGGAGCCTGAGGAC
AAGATCATGCCTGATCGCAAAATGCAATCCATGCCAGGTGAACCAGAGGAGCCTGAGGACAAGATCATGCCTGATCGCAA
AATGCAATCCATGCCAGGTGAACCAGAGGAGCCTGAGGACAAGATCATGCCTGATCGCAAAATGCAATCCATGCCAGGTG
AACCAGAGGAGCCTGAGGACAAGATCATGCCTGATCGCAAAATGCAATCCATGCCAGGTGAACCAGAGGAGCCTGAGGAC
AAGATCATGCCTGATCGCAAAATGCAATCCATGCCAGGTGAACCAGAGGAGCCTGAGGACAAGATCATGCCTGACCATAT
GCTGCGGTCCATGCCAGGTGAACCAGAGGAGCCTGAGGACAAGATCATGCCTGATCATAGACTACGGTCCATGCCGGGTG
CACCAGAGGAGCCTGAGGACAAGGTCATGCCTGATCATGAACTGCAACCCATGTGGGGTGAGCTAGAAGAACCTGATCCT
AAAACTATGCTCGATCACAAAGAAAAGCCTGATCATAAAGTGCAGTCCCTGGCGAGTGAACCAGAAGATCCTGACCAAAC
AGTTAAGCCTATGGGGTATGGTGAAGGTAGGGGCTATGGAAGTGGCGGTGGATATGGAGAAGGCATTGGCTCAAGCGGAG
GCAGTGGATATGGAGAAGGCATTGGCTCCAGTGGAGGCAGTGGCTATGGAGAAGGAAGAGGATCCGGGTCTGGCCAACCG
AACTGTGGTCCTGTCTTTGGAGCTCCAGGTAGTGGATACGGTGAAGGCATTGGACAAGGTAGTGGTTCAGGAGAAGGGAT
TGGTATCGGTATAGGAGGTGGCTCTAGTGGTAGTGTACCAAGTGTAGTTGTCCCAAGCATATCAATCCCTCCCATAACGG
TTCCAGGCACACAGATTCCCGGTTTTGTGATTCCAGGGGTCAGGGTTAATCCTGGTTATGGTTCCGGGGGATGCCAAACC
GGTGGTTGCACCCCAAGCGTACCTTATTACCGCCCTCCTATATACCAACAACCACCAAGCTGTTCCCATTGTGCACCTTT
CGTTTCAGGACAAGACAAGCACATGTCAGACAAAGGAACCGTGGCTGAAGAAGCTCTTGCACCCACTTCAAACGAGATGC
TCGTCTAA