Details for Kale Locus Bo5g127110

Position : C5 ( 5`- 39380162 .. 39382061 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127110

Protein [Map View]
MAGGNWIVSFEDLPCHLILEVLTSGRLNAFDLLSLELTSKKVFGGSCFGLYPLKFRSLADYAASQLCSVHPVYVGMGLAT
QKELFANCEGNWKRLLRFLQSVEQSSDMVETSAGNMQVTTGRYHTLLINNSKVYSCGSSLSGVLAHGPETTQCVAFTPVE
FPFSAQVAQVSATQNHSAFVLQSGEVLTCGDNSSHCCGHLDISRPIFRPKLVEALKGSPCKQAAAGLHFTVFLSREGRVF
TCGSNTHGQLGHGDTLDRPVPKAVESLQSVGPVVQISTGPSYVLAVTQDGSVYSFGSGSSFCLGHGEQQDEHQPRVIQAF
KRKGIHILRVSAGDEHAVALDSIGRVYTWGKGYCGALGHGDENDKITPQVLVSLNSCLAVQVCARKRKTFVLVEGGLLYG
FGWMGFGSLGFPDRGVSDKVLRPRVLECLKQHRVCQVSTGLYHTIVVTQGGRIFGFGDNERAQLGHDSLRGCLEPTEIFL
HCGRSRSRLY*

DNA
ATGGCTGGCGGAAACTGGATTGTTTCGTTTGAGGATCTTCCTTGTCATTTGATCTTGGAGGTGTTGACATCTGGGAGGCT
CAATGCGTTTGATCTGCTCAGCTTGGAGCTGACCTCGAAGAAGGTTTTCGGAGGGAGCTGCTTTGGATTGTACCCTTTGA
AGTTCAGGTCGCTAGCTGATTACGCGGCGTCTCAGCTTTGCTCTGTGCATCCTGTCTATGTTGGAATGGGTTTGGCTACG
CAGAAGGAGCTTTTCGCTAACTGTGAGGGGAACTGGAAGAGGCTTTTGAGGTTCTTGCAGTCTGTTGAGCAATCCTCGGA
TATGGTTGAAACCTCTGCAGGCAATATGCAAGTTACAACGGGAAGGTATCACACGTTGCTAATCAACAACTCAAAGGTTT
ACTCTTGTGGGTCGAGTTTGTCTGGTGTTCTTGCTCATGGACCAGAAACTACTCAATGCGTTGCGTTTACGCCTGTGGAG
TTCCCCTTCTCTGCTCAAGTAGCTCAAGTCTCAGCCACACAGAACCACTCTGCTTTTGTATTGCAGTCTGGAGAGGTTCT
CACATGTGGTGATAATTCATCGCATTGCTGTGGCCATTTAGATATCAGCCGTCCAATATTTAGGCCTAAGCTTGTTGAGG
CTTTGAAGGGATCTCCTTGTAAGCAGGCCGCTGCAGGGCTTCACTTCACTGTGTTTCTATCAAGGGAAGGGCGTGTGTTT
ACTTGTGGATCAAACACACACGGACAGCTTGGTCATGGAGATACCTTGGACAGACCAGTACCCAAAGCTGTTGAGTCTCT
TCAAAGCGTTGGCCCTGTGGTGCAAATTTCAACGGGACCGAGCTATGTTTTAGCTGTAACACAAGATGGCTCGGTGTACT
CGTTTGGCTCTGGATCTAGTTTCTGTCTTGGTCATGGAGAGCAGCAGGACGAGCACCAGCCGCGTGTCATTCAGGCTTTT
AAAAGAAAAGGTATCCATATACTCCGCGTCTCTGCAGGGGATGAACACGCCGTGGCACTTGATTCCATTGGCCGTGTATA
CACATGGGGTAAAGGTTACTGTGGTGCTCTAGGCCATGGAGATGAAAACGACAAGATCACTCCTCAAGTTTTGGTCAGTC
TCAACAGCTGCCTCGCTGTCCAGGTGTGTGCAAGAAAGAGAAAGACTTTTGTATTAGTGGAAGGTGGATTGTTGTATGGT
TTTGGGTGGATGGGATTTGGAAGCCTTGGCTTCCCTGACAGAGGAGTTTCTGACAAAGTCCTGAGGCCAAGAGTGTTGGA
GTGTCTGAAACAACACCGTGTGTGTCAAGTAAGCACAGGTTTGTATCACACCATTGTGGTGACTCAAGGTGGTCGCATAT
TCGGGTTTGGGGATAACGAAAGAGCTCAGCTTGGTCACGACTCGCTCCGTGGCTGCTTGGAACCTACCGAGATCTTTCTT
CATTGTGGCCGTTCTCGTAGCCGACTTTATTGA