Details for Kale Locus Bo5g127100

Position : C5 ( 5`- 39376576 .. 39377430 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127100

Protein [Map View]
MLAIFQKAFAHPPEELNSPASHSSGKYPKLPGETLSDFLSLHKDTAFSMTFGDSAVLAYSRPITPLRQRLFCGVDGIYCT
FLGALTNLCTLNRQYGLAGKNTSEAMFVIEAYRTLRDRGPYPADQVLRGLEGSFAFVVYDTQTSSVFSALSSDGGESLYW
GISGDGSVVMSDDVKIIKQGCAKSFAPFPTGCMFHSETGLKSFEHPMNEMKAMPRIDSEGVLCGANFKVDACSKVNGIPR
RGSEANWALANSR*

DNA
ATGTTGGCAATATTTCAGAAGGCTTTCGCTCACCCACCGGAAGAGCTCAACAGCCCGGCGTCTCACTCCTCCGGCAAATA
CCCAAAACTCCCCGGAGAAACCCTCTCCGACTTCCTCTCTCTCCACAAAGACACAGCTTTCTCCATGACCTTCGGCGACT
CCGCCGTATTAGCCTACTCCCGTCCCATCACCCCTCTTCGCCAGAGGCTGTTCTGCGGTGTAGACGGCATCTACTGTACC
TTTCTCGGCGCGTTAACCAATCTCTGCACGTTGAACCGCCAGTACGGACTCGCGGGGAAGAACACGAGCGAAGCCATGTT
CGTGATCGAAGCTTACCGAACACTGCGTGACCGCGGTCCTTACCCTGCTGATCAAGTCCTCAGGGGGTTAGAAGGAAGCT
TCGCCTTCGTTGTCTACGATACTCAGACCTCCTCTGTTTTCTCGGCTCTGAGCTCTGATGGAGGAGAGAGTCTTTACTGG
GGGATCTCTGGCGATGGATCTGTTGTGATGTCTGATGATGTGAAGATTATAAAGCAAGGATGTGCTAAATCGTTTGCTCC
TTTCCCTACTGGGTGTATGTTTCACAGTGAGACGGGGCTTAAGAGCTTTGAACATCCGATGAACGAGATGAAGGCGATGC
CGAGGATTGATAGTGAAGGTGTGTTATGTGGAGCTAATTTCAAAGTGGATGCTTGTTCTAAGGTTAATGGCATTCCTAGG
AGAGGAAGTGAAGCTAACTGGGCTCTTGCTAATTCTCGTTAA