Details for Kale Locus Bo5g127090

Position : C5 ( 5`- 39374070 .. 39375775 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127090

Protein [Map View]
MGRKRKHSEAEAAAPVKKDDSAPERPKRTLLGWKDKKEDVEEAKEVSAPSAPGFRNKEKVLVTCSRRISFRYRHLMLNIV
SLLPHCKKDSKVEAKSSKGATLNELVELKGSSSCLFFECRKHKDLYMWMVKSPSGPSVKFLVNAVHTMEELKLTGNHLKG
SRPLLTFSSNFDKDVHWKLLKEMLTQVFGIPKEHRKSKPYHDHVFAFSIVDDHIWFRNYQISVPHNEADKVARGGLDKMT
LVEVGPRFCLNPIKIFGGSFGGPTLYENPFYVSPNQIRALEKRNKAGKFAKKIKAKRRKKMHELSNPLEPDEFADMWKDD
E*

DNA
ATGGGGAGGAAGAGAAAGCACAGCGAGGCTGAAGCGGCGGCTCCGGTGAAGAAGGATGACTCTGCTCCGGAGAGACCCAA
GAGAACTCTGTTAGGTTGGAAAGATAAGAAAGAAGATGTTGAGGAAGCTAAGGAAGTGTCTGCTCCGTCTGCGCCTGGGT
TCAGGAATAAAGAGAAGGTTCTCGTTACTTGTTCCCGTCGGATTAGTTTCAGGTACCGGCATCTGATGTTGAACATAGTG
TCACTTCTGCCTCATTGTAAGAAAGATAGTAAGGTGGAAGCTAAGAGCAGTAAAGGCGCCACTCTTAATGAGCTTGTTGA
GCTTAAGGGCTCTTCTTCCTGCTTGTTTTTCGAGTGTAGGAAGCATAAAGATCTTTACATGTGGATGGTCAAGTCCCCTA
GTGGACCCTCTGTTAAGTTCTTGGTTAATGCTGTTCACACGATGGAGGAGCTGAAACTCACTGGAAACCATCTGAAAGGG
TCACGCCCTCTCTTGACGTTCTCGTCCAATTTTGATAAAGACGTGCACTGGAAACTCTTGAAAGAGATGTTAACACAGGT
TTTTGGAATCCCAAAGGAACACAGAAAGTCCAAACCTTACCATGACCATGTGTTTGCTTTCTCCATTGTCGATGACCATA
TCTGGTTCCGTAATTACCAGATATCAGTACCTCATAATGAGGCAGACAAGGTTGCGCGAGGTGGTCTTGATAAAATGACC
CTTGTCGAGGTTGGTCCAAGGTTTTGTTTAAACCCGATTAAGATCTTTGGAGGCAGCTTTGGAGGTCCAACCCTTTACGA
GAACCCATTCTACGTATCTCCAAACCAGATCCGAGCCTTGGAGAAAAGAAATAAAGCAGGGAAATTTGCAAAGAAGATCA
AAGCAAAAAGGAGGAAAAAGATGCATGAGCTTTCAAACCCATTGGAGCCTGATGAGTTTGCAGACATGTGGAAGGATGAT
GAATGA