Details for Kale Locus Bo5g127080

Position : C5 ( 5`- 39370703 .. 39373731 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127080

Protein [Map View]
MSNHREEEEEEEEPFHDSLDRLVSSSSCSCSASNSDYDSESSPRISSHDPEEPDGGGGPRRRHHPFPVPRFPMGASRFDL
WISEPASVSERRSKLLTEMGLNREPVRSRLKPVSDSGSDISRSISCNQLVRRDHGDCSETVGGSASFVVRSKSDCSVSQC
SDRDRLYHHPPQGNSCSCFDSKLSHSEISITVSADSTDPLRLEGSSDCVLVDEEVEVCTIKNLDNGKQFVVNEIQEEGST
WKQVKEVGTDTQMTMEEFEMSVGHSPIVQELMRRQNVEDSDNNDNASTKTTKDDEESKYNNNNNASKSKKKGSWFKSIKS
VVTGHSKERRSSDDKDTSSERGGRRSSSATDDSQESSFHGPERVRVRQYGKSSKELTAMYKTQEIQAHNGSIWSIKFSLD
GKYLASAGEDCIIHVWQVVEAEKRGELLLDRPELLLLANSNGSPEPTTMSPRRRGRSSVSRKSLSLENIYVPDSVFGLSD
KPFCSFHGHLDDVLDLAWSKSQDLLSASMDKTVRLWSLSTHTCLKVFSHSDYVTCIQFNPVDDRYFISGSLDAKVRVWSI
LDRQVVDWYDLHEMVTSACYTPDGQGALVGSYKGSCRLYSASDNKLQQKSQINLQNKKKKAHQKKITGFQFVPGSSSEVL
VTSSDSRIRVVDGTNLVTKLKGFRNTSSQISASITADGKYVVSASEDSNVYIWKYESPASRPSKSNNSSNKNVTVTNSYE
HFHSQDVSAAISWPGMASTESWGATQNRANNLDEVSTANHPPTPVDQPGTTTLDRLNSPRNGIISSATNGYFFDRMSATW
PEEKLMFGRNRSGNRLSTDLSNSGNVSASWGMVIVTAGLRGEIRAFQNFGLPIRI*

DNA
ATGAGCAACCACCGCGAGGAAGAGGAGGAGGAGGAGGAGCCCTTCCACGACTCTCTTGATCGCTTAGTCTCTTCCTCTTC
TTGCTCCTGCTCCGCTTCCAACTCCGATTACGACTCCGAATCCTCCCCTCGGATCTCCTCTCATGACCCCGAAGAGCCAG
ACGGTGGTGGTGGCCCCCGCCGTCGTCACCACCCATTCCCCGTCCCTCGGTTCCCAATGGGCGCTTCAAGGTTCGACCTT
TGGATCTCCGAGCCCGCCTCCGTCTCCGAGAGACGCTCTAAGCTTTTAACCGAAATGGGCCTAAACCGAGAACCGGTTCG
CTCCCGGTTAAAGCCCGTTTCCGATTCCGGTTCTGACATTTCTCGATCGATCTCGTGTAATCAGTTGGTCCGGCGAGATC
ACGGAGATTGCTCCGAAACTGTCGGCGGCAGCGCTTCCTTCGTCGTGAGATCGAAGTCAGATTGTTCCGTTAGCCAATGC
AGCGATCGTGACCGTCTTTATCATCATCCTCCTCAGGGTAATTCATGTTCTTGTTTTGACTCTAAGCTCTCGCATTCAGA
GATCAGTATAACAGTTAGTGCTGATTCAACTGATCCCTTGCGGTTAGAAGGAAGTTCTGATTGTGTGTTAGTGGATGAGG
AAGTGGAAGTGTGTACTATTAAGAATCTAGACAACGGGAAACAGTTTGTGGTGAACGAGATTCAAGAAGAGGGTAGTACA
TGGAAACAAGTGAAGGAAGTGGGGACCGACACGCAGATGACAATGGAGGAGTTTGAGATGTCTGTGGGACACTCTCCCAT
TGTTCAGGAGCTTATGAGAAGACAGAACGTGGAGGATTCTGATAACAACGACAACGCATCAACCAAAACAACAAAGGATG
ATGAAGAGAGTAAATATAATAATAATAATAATGCATCAAAGTCTAAGAAGAAAGGAAGCTGGTTCAAGAGCATCAAGAGC
GTTGTGACTGGTCACAGCAAAGAGAGACGAAGCAGCGATGATAAAGACACGTCATCGGAGAGAGGCGGCCGGAGGTCGAG
CTCAGCTACGGATGACTCTCAGGAATCTTCTTTCCACGGGCCGGAGAGAGTTAGGGTAAGACAGTACGGGAAGTCTTCCA
AAGAGCTCACGGCGATGTACAAGACGCAGGAGATTCAAGCGCATAACGGCTCTATCTGGAGCATTAAGTTTAGTTTGGAT
GGTAAGTATCTCGCTAGCGCCGGCGAGGACTGCATCATTCATGTTTGGCAAGTGGTTGAGGCTGAGAAGAGAGGAGAGTT
GTTACTGGATAGACCGGAGCTGTTGCTTTTGGCTAATAGTAATGGATCTCCGGAACCGACTACTATGTCGCCGAGGAGAA
GAGGGAGGAGTTCTGTGAGTAGAAAGTCGTTGAGTTTGGAGAACATATATGTTCCAGATTCTGTTTTTGGGCTCTCTGAT
AAACCCTTTTGTTCCTTTCATGGACATCTGGATGATGTTCTTGATCTTGCTTGGTCCAAGTCTCAGGATTTGCTGTCTGC
ATCAATGGATAAGACAGTTCGTTTGTGGAGCTTGTCTACCCACACTTGCTTGAAAGTATTCTCTCACAGTGATTATGTGA
CTTGCATTCAATTTAATCCGGTTGATGATAGATACTTCATCAGCGGTTCGTTAGATGCAAAAGTTCGCGTGTGGAGCATT
CTGGATCGGCAAGTAGTTGACTGGTATGATCTTCACGAGATGGTCACTTCTGCTTGCTACACTCCAGACGGTCAGGGTGC
GTTGGTTGGTTCATACAAAGGTAGCTGTCGTCTTTACAGTGCATCAGATAACAAGCTGCAACAGAAAAGCCAGATAAATT
TACAGAACAAGAAGAAGAAAGCTCATCAGAAAAAGATAACTGGTTTCCAGTTTGTGCCTGGAAGCTCATCTGAAGTGCTA
GTCACATCTTCGGACTCTCGGATCCGCGTTGTTGATGGAACTAATCTAGTTACTAAACTCAAAGGGTTTCGAAACACGAG
CAGCCAAATCTCCGCCTCAATAACAGCAGACGGCAAATACGTAGTGTCAGCGAGCGAGGATTCAAACGTGTACATATGGA
AGTACGAATCCCCTGCTTCTCGACCAAGCAAGAGCAACAACAGCAGCAACAAGAACGTCACAGTCACAAACTCTTACGAG
CATTTCCACAGCCAAGACGTCTCTGCAGCCATCTCATGGCCCGGGATGGCCTCAACAGAGTCTTGGGGAGCCACCCAAAA
CAGAGCCAACAACTTAGACGAAGTCTCCACAGCTAACCATCCACCCACACCTGTAGACCAGCCAGGGACAACAACTCTGG
ACCGACTCAACAGTCCACGTAACGGGATCATTTCGAGCGCCACGAACGGATACTTCTTCGATAGAATGTCAGCGACTTGG
CCTGAGGAGAAGCTGATGTTTGGGAGGAACAGAAGTGGGAACCGTCTGAGTACGGATTTGTCTAACTCAGGGAACGTGTC
GGCTTCTTGGGGGATGGTGATAGTCACTGCAGGTTTGAGAGGAGAGATTAGAGCGTTTCAGAACTTTGGTTTGCCTATAA
GGATTTGA