Details for Kale Locus Bo5g127070

Position : C5 ( 5`- 39355438 .. 39356386 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127070

Protein [Map View]
MASKLVVIIVFILDLIAVGLAIAAEQRRSVGKVVTDTEKTYEYCVYGTDIATSYGAGAFLLLFISQVLIMSASRCFCCGK
SLNPGGSRACALLLFLICWVFFLVAEVCLLAASIRNAYHTQYRTMWNIENPPSCEVIRRGVFAAGAAFTLFTAIVSQFYY
VCYSRARDAYQNPSY*

DNA
ATGGCTTCGAAGCTCGTAGTCATAATTGTGTTCATCCTCGATCTCATCGCCGTTGGTTTAGCCATTGCCGCCGAGCAGAG
AAGAAGTGTCGGAAAAGTTGTAACGGACACTGAGAAGACATATGAGTACTGTGTGTACGGCACGGACATTGCTACAAGCT
ATGGAGCTGGTGCGTTCCTTCTCCTCTTTATAAGCCAAGTCCTTATCATGAGTGCTAGCCGTTGCTTCTGCTGTGGGAAG
TCCCTTAACCCCGGCGGTTCAAGAGCTTGTGCCCTCCTTCTCTTCCTCATTTGCTGGGTATTCTTCCTGGTCGCTGAGGT
ATGTTTGCTTGCTGCATCAATCAGAAACGCGTACCACACACAATACAGAACGATGTGGAACATCGAAAACCCGCCAAGCT
GTGAAGTTATAAGGAGAGGTGTGTTTGCCGCTGGTGCTGCTTTTACCCTCTTCACCGCTATCGTCTCTCAGTTCTATTAC
GTTTGCTACTCTCGTGCTAGAGATGCTTACCAGAATCCGTCCTACTAA