Details for Kale Locus Bo5g127060

Position : C5 ( 5`- 39346384 .. 39347485 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127060

Protein [Map View]
MMFAKKTEQKFGCYCNVFAVWSRSSRWQKASKCKLHIQNLLCSVKVQRARTECMVRQSRSDIAQLVPYGRFREALPKAKQ
FYEDERRLLAYDQVKYLCTSILQSFSPLLHQSDVHLLPDEMKEAMAGLIFAASRIGELKELQIIRCLFVQRFGQKFDKDC
VDLRPGNLVSSEIVNILDTTMPQDAISPEIIMAISQKYQTDFITSVDSITEDSASLNNLGNADSDTLARRKKVTKENPKC
LHTDRGESQERDRSKFMR*

DNA
ATGATGTTTGCCAAGAAAACAGAACAGAAGTTCGGATGCTATTGTAATGTTTTTGCTGTTTGGTCTCGTTCTTCAAGATG
GCAAAAAGCTTCAAAGTGCAAACTCCATATCCAGAATCTGCTATGTTCTGTCAAGGTGCAACGAGCACGAACAGAGTGTA
TGGTCAGACAGTCCCGGTCCGATATTGCTCAACTCGTTCCTTACGGCCGCTTTCGTGAAGCACTTCCTAAGGCGAAGCAG
TTCTATGAAGATGAGAGAAGGCTATTAGCTTACGATCAGGTCAAGTACTTGTGCACATCTATATTGCAGAGTTTTTCTCC
CCTACTTCATCAAAGCGATGTTCATCTCTTACCGGATGAAATGAAAGAAGCAATGGCCGGACTGATATTTGCCGCATCAA
GAATCGGGGAGCTTAAGGAGCTACAAATCATAAGGTGCTTGTTCGTTCAAAGATTTGGGCAGAAGTTTGACAAAGATTGC
GTAGATTTGCGTCCAGGGAACCTAGTGAGCTCGGAGATAGTTAACATTCTAGACACGACTATGCCGCAAGATGCAATTAG
TCCAGAGATCATAATGGCAATTTCACAAAAGTACCAAACCGACTTCATTACTTCCGTGGATTCAATAACTGAAGATTCAG
CTTCACTTAATAATCTTGGCAATGCTGATTCTGATACGCTTGCAAGGAGAAAGAAAGTCACGAAGGAGAATCCAAAGTGT
CTGCATACAGATCGTGGAGAGTCTCAAGAAAGAGATCGGTCAAAGTTCATGAGATAA