Details for Kale Locus Bo5g127040

Position : C5 ( 5`- 39335083 .. 39336289 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127040

Protein [Map View]
MGIQELDPLAQLSLPPGFRFYPTDEELMVDYLCRKAAGHDFSLQLIAEIDLYKFDAWVLPSKALFGEKEWYFFSPRDRKY
PNGSRPNRVAGSGYWKATGTDKVISTEGRRVGIKKALVFYVGKAPKGTKTNWIMHEYRLIEPSRRNGSTKLDDWVLCRIY
KKQSSAQKQAYGNLMTSASEYSNNGSSTSTSSHQYDDVLESLHEIDNRSLGYAAGSSHTIPHYNHRPGLTEQKTGFLDLA
REQSYNWTNFGGHNSVQELGRNLNIPSLRYGDGGGYLHGLKTNEEDDKTQQQQAEGIPRFNNSGVLAHDQSFSVDPVNGF
GYSGQQPSGFGFM*

DNA
ATGGGTATTCAAGAACTTGACCCGTTAGCCCAGCTTAGCTTACCACCGGGTTTCCGGTTTTACCCTACCGACGAAGAGCT
GATGGTTGATTATCTATGCAGAAAAGCCGCCGGTCACGACTTCTCTCTCCAGCTCATCGCCGAGATTGATCTCTACAAAT
TCGACGCGTGGGTTTTACCAAGCAAGGCGTTGTTCGGGGAAAAAGAATGGTATTTTTTCAGCCCAAGGGACAGGAAGTAT
CCGAACGGGTCCAGACCCAACCGGGTTGCTGGGTCCGGTTATTGGAAAGCAACCGGTACGGATAAGGTTATCTCGACCGA
GGGAAGAAGAGTTGGTATCAAGAAGGCTTTGGTGTTTTACGTTGGAAAAGCACCAAAAGGTACCAAAACTAATTGGATCA
TGCATGAGTACCGTCTCATCGAACCCTCTCGCAGAAATGGAAGCACCAAGCTTGATGATTGGGTCCTATGTCGAATATAC
AAGAAGCAATCAAGCGCGCAAAAACAAGCTTACGGCAATCTAATGACAAGTGCAAGTGAATATAGCAACAATGGTTCGTC
CACGTCAACTTCATCTCACCAATACGACGACGTTCTTGAGTCCTTGCATGAGATAGACAACAGAAGTTTGGGTTATGCTG
CCGGTTCATCACACACTATTCCTCATTATAATCATAGACCGGGTTTAACCGAACAGAAAACCGGGTTTCTTGATTTAGCA
AGGGAACAGAGTTATAATTGGACGAATTTTGGTGGACACAACTCGGTCCAGGAGCTAGGACGGAATCTTAACATTCCAAG
TCTCCGTTACGGCGACGGTGGTGGCTATTTACACGGTTTGAAGACAAACGAAGAAGACGATAAGACGCAGCAACAACAAG
CTGAGGGGATTCCTCGGTTTAATAACTCGGGCGTGTTGGCTCATGATCAAAGTTTCAGTGTTGACCCCGTTAACGGCTTC
GGGTACTCGGGTCAACAACCTAGTGGTTTCGGGTTTATGTGA