Details for Kale Locus Bo5g127010

Position : C5 ( 5`- 39286923 .. 39287243 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g127010

Protein [Map View]
MQAVRRIPSGEGAEMRGRSETNRVRRKSHGSSLRVRQPCTCSGRPGSAKCVRHGFMVPSNEKLMRKASDGSREVLRRALT
PPIRRMNLRWLNFRPTPSRLCKMSSV*

DNA
ATGCAGGCTGTGAGAAGGATCCCATCAGGAGAAGGTGCAGAGATGCGTGGAAGATCCGAGACCAACCGGGTCAGACGTAA
GAGTCACGGGTCAAGTCTGAGAGTTCGACAGCCTTGCACGTGTTCAGGACGGCCTGGCTCTGCCAAGTGCGTGCGCCACG
GGTTTATGGTGCCAAGCAACGAGAAGCTTATGCGAAAGGCGAGTGACGGAAGCAGAGAGGTGTTGAGAAGAGCTTTGACG
CCTCCGATCCGGCGGATGAATCTCCGGTGGTTGAATTTCCGGCCAACACCTAGCCGACTCTGTAAAATGTCTTCCGTTTG
A