Details for Kale Locus Bo5g126960

Position : C5 ( 5`- 39254097 .. 39254303 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126960

Protein [Map View]
MVCFCFMVDQKRKMKASKPAAGMCSRCGRGARIADMKTSTRFCLIPIYCRSWRAIVCSFCGSVLKSYR*

DNA
ATGGTGTGTTTCTGTTTCATGGTGGACCAGAAGAGAAAGATGAAAGCAAGCAAACCAGCGGCGGGAATGTGTTCTCGGTG
CGGTCGTGGTGCAAGAATCGCTGACATGAAGACTTCAACGAGGTTTTGTCTAATACCTATTTATTGCAGATCTTGGAGAG
CCATCGTCTGCAGCTTTTGCGGCTCTGTTCTTAAATCCTACCGTTGA