Details for Kale Locus Bo5g126940

Position : C5 ( 5`- 39216187 .. 39217374 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126940

Protein [Map View]
MEKGGVEHEITELRLGLPGRDVTEKIVKKRGFTEMIMTSSGSNSDESGVVSGGDVEKINESPAAKSEVVGWPPVCSYRRK
NNCKEAWTTKVGLGYVKVSMDGVPYLRKIDLGSSQDYDDLAFALDKLFGVRGIGVALKNGDNCEYVTIYEDKDGDWMLAG
DVPWGMFIESCKRLRIMKRSDATGFGLQPRGVDE*

DNA
ATGGAGAAAGGTGGAGTTGAGCATGAGATAACTGAGCTGAGATTGGGTCTTCCGGGGAGAGATGTGACGGAGAAGATTGT
GAAGAAGAGAGGCTTCACGGAGATGATCATGACGTCTTCTGGAAGTAACAGTGATGAAAGTGGTGTCGTTTCAGGTGGTG
ACGTGGAAAAAATTAATGAGTCACCCGCGGCGAAAAGTGAGGTGGTGGGATGGCCGCCGGTTTGTTCTTACCGGAGGAAG
AACAACTGTAAGGAAGCTTGGACGACAAAAGTGGGGTTAGGGTACGTGAAAGTGAGCATGGATGGTGTGCCTTACTTAAG
GAAGATAGATCTTGGTTCGAGCCAAGACTATGATGACTTAGCATTTGCTCTCGATAAGCTCTTTGGTGTCCGTGGCATTG
GAGTGGCCTTGAAAAATGGTGATAACTGCGAATACGTTACCATATACGAAGATAAAGATGGGGATTGGATGCTCGCTGGA
GATGTACCATGGGGAATGTTCATAGAGTCATGCAAGAGGTTGAGGATTATGAAAAGATCGGATGCTACCGGGTTTGGTCT
GCAGCCTAGAGGAGTAGACGAGTGA