Details for Kale Locus Bo5g126850

Position : C5 ( 5`- 39152426 .. 39155337 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126850

Protein [Map View]
MLSDYGITEEDMVIGEAQGYPIAYAKICRDFDSSPYKNGPPFTFMPYTLQHNENSRCREVDKMFPVIDPKARPTTKPKIF
LSLLWKQLSHLGNAGFDPAVIRIDPYGNVLYFHADSASPLAWGFDHWFPLSRGGLTVPSNLRIVQWQARKNKKDKLEFLV
PWWDLQVGISVNQFLSIFAASSSDFKRRAFSFLFKEGESEELNGSQTVDSHRFPQHFVESKEKFGLASAAVVVSRRDPYD
PSLVLRSLDHNSQTPARKENETPDLMKNPYQAIVAARDSLRHREEAQNMRVEMKKLDEEMNDLKRKNSEEQLTIQELESE
LIKRRRRAEKGRRLAEAQCSYRNTLEKMIRDAMHQSVVYKEQVRLNQAASSALMARLEAQKAICDGSEKELHKKFKEREE
LENQVRPELEKARKRSRLLLSNEDELLLEDRDKKLSLYLPGTSEDKSLNKELATSEAETQKHGEIEEVEEEQKIPEVSEK
SLVQLEEKRDSRSFRAVPVLKEQESEEDEESRRERGKGNVEKWLHILLENNVKITNPQDLQAERSKKIDELIEQLDHKFP
LLDKVSEEDVLDLQLLQAVEANNNNTDKVETRAESSRRSRTSFDSKNTPEKSGRDKVVKRSESARAFRRIPSSPSLIFGM
KKGNMKKPVVSGHDDEDEYLVKNNFIKSSLQTIKRAVKF*

DNA
ATGTTGAGCGATTATGGTATAACGGAGGAAGACATGGTAATCGGGGAAGCTCAGGGCTACCCGATAGCTTACGCAAAGAT
CTGTCGCGACTTCGATTCTTCTCCGTACAAAAATGGCCCTCCTTTCACCTTCATGCCGTATACTCTGCAACACAACGAGA
ACTCAAGATGCAGAGAAGTAGATAAGATGTTCCCTGTAATTGATCCGAAAGCAAGACCAACAACGAAACCTAAGATCTTC
TTAAGTCTCCTATGGAAACAACTTAGTCATCTAGGCAATGCTGGGTTTGATCCGGCTGTTATTCGGATAGATCCGTATGG
GAATGTTCTCTACTTCCACGCTGACTCAGCTTCTCCTCTCGCTTGGGGCTTTGATCATTGGTTCCCTCTCTCAAGAGGAG
GTTTAACAGTACCAAGCAACTTAAGGATAGTGCAATGGCAAGCACGCAAGAACAAAAAGGACAAACTTGAGTTCTTAGTA
CCATGGTGGGATCTTCAAGTTGGCATTTCAGTGAATCAGTTCCTGTCTATTTTCGCTGCTTCGAGTTCTGATTTCAAGAG
GAGAGCGTTTTCGTTCTTGTTCAAAGAAGGCGAAAGCGAGGAACTTAACGGCTCACAGACCGTTGACTCGCATCGTTTCC
CTCAGCATTTTGTTGAATCAAAGGAGAAGTTTGGTCTTGCTTCAGCTGCAGTTGTTGTCTCTAGAAGAGATCCTTATGAC
CCTTCACTAGTCTTGAGGTCTCTCGATCACAATAGTCAAACACCTGCAAGGAAAGAGAATGAGACTCCAGACTTAATGAA
GAATCCTTATCAAGCCATTGTTGCTGCTAGGGACTCACTGAGACACAGAGAGGAAGCTCAGAATATGAGAGTTGAGATGA
AGAAGTTAGATGAGGAAATGAATGATTTGAAAAGAAAGAACAGCGAAGAGCAGCTTACTATACAGGAGCTGGAGAGTGAG
CTGATTAAGCGGCGAAGAAGAGCTGAAAAGGGCAGGCGATTGGCAGAAGCTCAATGCTCGTATAGGAATACACTCGAGAA
AATGATCCGTGATGCTATGCACCAGAGTGTTGTGTATAAGGAACAAGTGAGGTTAAACCAGGCTGCAAGTAGTGCGCTTA
TGGCGAGGTTAGAGGCGCAGAAGGCGATTTGTGATGGTTCGGAGAAAGAGCTTCACAAGAAGTTTAAAGAGAGAGAGGAG
CTGGAGAATCAAGTGAGGCCTGAACTGGAGAAAGCAAGGAAAAGATCAAGACTTTTGCTGAGTAATGAAGATGAACTGCT
GCTAGAAGATAGAGACAAGAAGTTGTCTTTGTACCTTCCTGGAACAAGTGAAGACAAGTCTTTAAACAAGGAGTTAGCAA
CTTCTGAGGCTGAAACTCAGAAGCATGGGGAGATAGAAGAGGTGGAAGAGGAGCAGAAGATTCCAGAAGTGTCTGAGAAG
TCTCTGGTTCAATTAGAAGAGAAGAGAGACAGCAGAAGCTTCAGAGCAGTTCCTGTTTTGAAGGAACAAGAGAGTGAAGA
AGATGAGGAAAGCAGGAGAGAGCGAGGGAAAGGAAACGTTGAGAAATGGCTCCACATATTACTCGAGAACAACGTCAAAA
TCACCAATCCACAGGATCTTCAAGCTGAAAGAAGCAAAAAGATCGATGAACTGATAGAGCAACTGGATCACAAGTTCCCT
CTACTTGACAAGGTTAGTGAAGAAGATGTGTTGGACTTGCAGTTGCTGCAGGCTGTGGAGGCAAACAACAACAACACAGA
CAAGGTGGAAACAAGAGCTGAAAGCTCACGTAGAAGCAGAACGAGTTTTGATTCGAAGAACACACCAGAGAAGAGCGGGA
GAGACAAAGTGGTGAAGAGATCAGAGAGTGCTAGAGCTTTCAGAAGGATCCCATCATCTCCTTCACTCATCTTTGGAATG
AAAAAGGGGAATATGAAGAAGCCAGTGGTTTCAGGTCATGACGATGAGGATGAATATCTTGTTAAGAACAACTTCATCAA
GTCATCTCTTCAAACAATCAAAAGAGCTGTCAAATTCTAG