Details for Kale Locus Bo5g126840

Position : C5 ( 5`- 39149218 .. 39152030 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126840

Protein [Map View]
MKKAPSPEPVTISGNHSPHHDQEKFAGDVEYYSWFDEACIQDMNYFVKTITGIKSKGIRPDLIGSIIAHYASKWLPDLSG
NVSAITTPPPTESVTASVMKKRFFVETLIGILPPEKDSVPCNFLLRLLRTAKMVGANPNYLTELENRVAWQLDQASLKEL
MIPSFSHTSGTLLDVELVTRLVKKFVGLDSEGVKTGAALVKVAKLVDSYLAEAALDGGLTLPEFISLIEALPSYARTTED
GLYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRSIIRVLFTEQTKLSRHVDWSGSLTRSPTNP
SGSHYFEQGGSGARCLSKREMNVQQAEIKRLREDVARLQSECSAMHLQVERLLEKKSGGSKGFFRWKRLGLVPSIRGSVS
VEEMTNCENGEGFEPQTPGNMKTRLVKGRTPSRWRKSMS*

DNA
ATGAAGAAAGCACCTTCGCCGGAACCCGTCACTATCTCCGGCAACCATTCGCCGCATCATGACCAAGAAAAGTTCGCCGG
AGACGTGGAGTACTACTCTTGGTTCGACGAAGCTTGCATCCAAGACATGAACTACTTCGTCAAAACCATCACCGGCATCA
AATCCAAAGGCATCCGACCAGACCTCATCGGCTCAATCATCGCTCATTACGCTTCCAAATGGCTCCCTGATCTCTCCGGC
AACGTCTCCGCCATCACGACACCACCACCGACGGAAAGCGTCACGGCTTCTGTAATGAAAAAACGTTTTTTCGTCGAAAC
CCTTATCGGAATCCTCCCGCCGGAGAAAGACTCCGTTCCTTGCAACTTCCTCCTCCGTCTACTCAGGACGGCGAAGATGG
TCGGAGCGAATCCTAACTACTTAACGGAGCTCGAGAACAGAGTGGCTTGGCAGCTGGACCAAGCCTCGCTCAAGGAGCTC
ATGATACCTTCCTTCAGCCACACGTCTGGGACTTTGCTTGACGTTGAGCTCGTGACTCGTCTCGTGAAGAAGTTCGTTGG
CTTGGATAGTGAAGGTGTTAAAACCGGCGCGGCTTTAGTTAAAGTGGCTAAGCTTGTTGACTCTTACTTGGCTGAAGCCG
CCCTAGACGGTGGCTTGACTCTACCGGAGTTTATATCCCTTATTGAAGCTCTGCCTAGCTATGCTCGTACCACGGAGGAT
GGCTTGTACCGCGCCATTGATACATACCTCAAGGCTCATCCTCAGGTGTTGAAGCAAGAAAGGAAAGAACTTTGCAGACT
CATTGATAGCAGAAAGCTATCACCAGAAGCAGCTCTCCACGCGGCTCAGAACGATCGCCTCCCGGTGAGATCAATCATCA
GAGTGTTGTTCACCGAGCAGACAAAGCTAAGCCGTCACGTTGACTGGAGTGGTAGCTTGACGAGGAGTCCAACAAACCCT
TCTGGCTCACATTACTTTGAGCAAGGAGGCTCTGGAGCGAGGTGCTTGTCTAAACGCGAGATGAACGTTCAGCAAGCAGA
GATAAAAAGACTTAGAGAGGATGTGGCGAGGCTGCAGAGCGAGTGCAGTGCCATGCATTTGCAGGTTGAGAGGCTTTTGG
AGAAGAAGAGTGGTGGGAGTAAAGGGTTTTTCAGGTGGAAGAGGCTAGGGTTAGTGCCTTCTATTAGAGGAAGTGTTAGC
GTTGAAGAGATGACGAACTGTGAGAATGGTGAAGGGTTTGAACCTCAGACTCCTGGGAATATGAAGACAAGGCTTGTCAA
AGGAAGAACACCTTCAAGATGGAGAAAATCTATGTCTTAG