Details for Kale Locus Bo5g126830

Position : C5 ( 5`- 39143908 .. 39147159 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126830

Protein [Map View]
MYSISKILRRSSRFNLAPSSFGAVSKLEISIGTKESSFRASGLNFSNKSQGLVRRYSVRDVFSRFIGINKLSSVADGKGD
EEEKEAFPVSGDAAEGVEDDSVFDSELGSDVEDACDDGLEVEVEHSKEGKAKKTRARCELYDSIVAYKSVKHVLEQWVKE
GKDLSQAEVSLAVHNLRKRRSYAMCLQLWEWLRANTQFEFTEANYASQLDLVAKVHSLQKAEAFLNDIPESSRGEVVYRT
LLANCVLKLHVKRAEDLFNKMRELKFPTSVFACNQLLLLYSKHDRKKIPDVLLLMEKENIKPTRGTYQFLINSKGLSGDI
AGMDKLVETMKEEGIKLDPEIQAAVARYYMRAGRKERAEEVMKEIEGEGLEQAPWVCRSLLPLYAEIGDKENVRRLSRFV
EQALRYDNSIAAIKAWGKLKEIEEAEAVFDKLVEKYKLVPMLPYFSLMEIYTENKMLTKGKNLVKRIARAGVKIGPSTWH
ALVKLYIKAGEVGKAEMILNKATKDNKMRPLFVSYMVILEEYAKRGDVHNAEKVFLRMKRAGYAAQLMQYETVLLAYVNA
KTPAYGMSERMKVDNVFPNKSLAAKLAQRTTRLERCGRVVPEFGKKILRNWAAKYFNLSPYERLAESREIIAKYPTRIPV
IAEKYSKTDLPAIEKKKFLVPRDMSVGQFIYILSARLHLSPGKALFVFVNNTLPQTAALMDSIYETYKDEDGFVYMCYSS
EKTFG*

DNA
ATGTATTCGATCTCAAAGATCCTGCGAAGGAGTTCAAGATTCAATCTTGCGCCTTCTTCGTTTGGTGCTGTTAGTAAGCT
AGAGATATCAATTGGTACCAAAGAAAGTTCTTTCAGAGCATCTGGATTGAATTTTAGCAACAAATCACAAGGTTTAGTCA
GACGCTATTCCGTGAGAGATGTGTTCTCACGCTTCATTGGCATCAACAAGCTTTCTTCTGTAGCTGATGGTAAAGGAGAT
GAGGAAGAGAAGGAGGCGTTTCCTGTTTCTGGGGATGCAGCAGAGGGAGTTGAAGACGATTCTGTATTTGATTCTGAGCT
TGGTAGTGACGTAGAAGATGCGTGTGATGATGGTCTTGAAGTTGAAGTGGAGCATTCTAAGGAGGGAAAAGCTAAAAAGA
CAAGAGCGCGCTGTGAGCTGTATGACTCCATCGTTGCATATAAATCAGTGAAACATGTTCTTGAACAGTGGGTTAAAGAA
GGCAAAGATTTGAGTCAAGCAGAGGTTTCTCTCGCTGTTCACAACCTGCGTAAACGCAGATCCTACGCTATGTGTTTGCA
GCTCTGGGAGTGGCTGCGAGCTAACACACAGTTTGAGTTCACAGAAGCAAACTACGCTTCTCAGTTGGATTTGGTGGCCA
AGGTGCATAGTTTGCAAAAAGCTGAAGCCTTTCTGAATGATATTCCAGAATCTTCCAGAGGGGAAGTAGTCTACAGAACG
CTGCTTGCAAACTGTGTCCTTAAGCTCCACGTGAAAAGAGCCGAAGACCTTTTCAACAAAATGAGGGAACTTAAGTTCCC
AACGAGCGTGTTCGCTTGCAACCAGCTGCTTCTCCTCTACAGCAAGCACGACAGGAAGAAGATACCTGACGTTTTGTTAC
TCATGGAGAAAGAAAACATCAAGCCCACTCGCGGCACTTATCAGTTCCTAATCAACAGTAAAGGTTTATCCGGGGACATA
GCTGGAATGGACAAGCTAGTGGAGACGATGAAGGAAGAAGGCATTAAGCTAGATCCCGAGATACAAGCTGCAGTGGCTAG
ATACTACATGAGAGCGGGGCGTAAAGAGCGAGCAGAGGAAGTTATGAAGGAGATTGAAGGGGAAGGATTGGAGCAAGCTC
CATGGGTGTGCCGTTCGTTGCTCCCTCTTTACGCAGAGATAGGAGACAAGGAGAACGTGAGAAGGCTGAGTAGGTTTGTT
GAACAAGCGTTGAGGTATGATAATAGTATCGCTGCTATCAAAGCGTGGGGAAAGCTGAAGGAGATCGAGGAAGCAGAGGC
GGTGTTTGATAAACTCGTGGAGAAGTACAAACTCGTCCCCATGCTGCCGTACTTTTCTCTCATGGAGATATACACTGAGA
ACAAGATGCTGACGAAAGGCAAAAACCTTGTCAAAAGAATAGCGAGGGCAGGGGTCAAGATCGGCCCTTCGACATGGCAT
GCGCTTGTGAAGCTCTATATCAAAGCTGGGGAAGTTGGAAAAGCTGAGATGATATTGAACAAAGCTACGAAGGATAACAA
GATGAGACCTTTGTTTGTTTCTTACATGGTGATACTCGAGGAGTACGCGAAGAGAGGGGATGTTCATAACGCGGAGAAGG
TTTTCCTGAGGATGAAGAGGGCAGGGTATGCAGCTCAGCTAATGCAGTATGAGACTGTGCTGTTGGCGTATGTGAATGCT
AAAACGCCTGCGTATGGGATGAGTGAGAGGATGAAGGTGGATAATGTGTTCCCGAACAAGAGTCTTGCTGCGAAACTGGC
TCAGAGAACAACCAGATTAGAGAGATGTGGAAGAGTTGTTCCCGAGTTTGGAAAGAAGATTCTCAGAAACTGGGCTGCTA
AATATTTTAATTTAAGCCCATATGAAAGGCTCGCGGAATCGAGGGAGATCATCGCCAAGTATCCTACTCGGATTCCTGTA
ATTGCTGAGAAGTATTCTAAGACCGATCTGCCTGCAATCGAGAAAAAGAAGTTCCTGGTTCCACGAGATATGTCGGTTGG
ACAATTCATCTACATCTTGAGTGCTAGATTACACTTGTCTCCTGGTAAAGCCTTGTTCGTCTTCGTCAACAACACTCTCC
CTCAAACTGCTGCTCTGATGGACTCCATCTACGAGACTTACAAAGACGAAGATGGATTCGTTTACATGTGCTACAGCAGT
GAGAAAACCTTTGGCTGA