Details for Kale Locus Bo5g126800

Position : C5 ( 5`- 39133171 .. 39135184 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126800

Protein [Map View]
MWRRIVSSGLKTLASDVAAASPRRSVRPLRFNLASNQASSSLFPRHFSSESVETVGKKKKVEDVMPIATGHEKEELEAEL
EGRRLLDIDFPEGPFGTKEAPAIVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVGPGGPPDGH
GDEDDEHHH*

DNA
ATGTGGAGAAGAATCGTCTCCTCTGGTCTCAAAACCCTAGCCTCCGATGTCGCCGCTGCTTCTCCTCGTCGATCCGTGAG
ACCCTTGAGGTTCAATCTCGCATCCAATCAAGCTTCTTCTTCCCTTTTCCCTCGCCATTTCAGCTCCGAATCAGTGGAGA
CCGTTGGGAAGAAGAAGAAGGTGGAGGATGTAATGCCCATTGCTACTGGACATGAAAAGGAGGAGCTTGAAGCTGAACTT
GAGGGGAGGAGGCTGCTTGACATTGACTTCCCTGAAGGTCCTTTTGGAACTAAGGAAGCTCCTGCTATTGTAAAGTCCTA
CTATGACAAGCGAATTGTGGGATGCCCTGGTGGTGAAGGCGAGGATGAACACGACGTTGTGTGGTTCTGGCTGGAGAAAG
GAAAGTCTTTTGAATGCCCGGTTTGCACTCAGTACTTTGAGCTGGAGGTGGTTGGTCCAGGTGGACCTCCCGATGGTCAC
GGTGATGAAGACGATGAGCACCACCACTGA