Details for Kale Locus Bo5g126790

Position : C5 ( 5`- 39125137 .. 39126697 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126790

Protein [Map View]
MSYSHQSMGSGSRSGRGHEFGRTYVVRPKGKHQATIVWLHGLGDNGSSSSQLLESLPLPNIKWICPTAPSRPVSLLGGFP
CTAWFDVGEISEDLQDDIEGLDASAAHIANLLSTEPTDVKVGIGGFSMGAAIALYSTTCYALGRYGTGHPYTINLRATVG
LSGWLPGWRSLRSKIESSNEAARRAATIPVILTHGTSDDVVPYRFGEKSAYSLAMAGFRQVVFKPYEGLGHYTVPKEMEE
VVHWLASRLGLEGWR*

DNA
ATGAGCTATTCTCATCAAAGCATGGGTTCTGGCAGTAGAAGTGGAAGAGGACATGAGTTTGGAAGGACTTATGTTGTGAG
GCCTAAAGGAAAACACCAAGCTACTATTGTTTGGTTGCACGGTCTTGGAGACAATGGCTCAAGCTCGTCTCAGCTCTTGG
AGAGCCTTCCTCTTCCAAACATAAAATGGATTTGTCCAACTGCTCCTTCTCGTCCTGTTTCTCTTCTTGGAGGATTCCCT
TGCACTGCCTGGTTCGACGTGGGAGAAATTTCTGAGGATCTTCAAGATGATATAGAAGGCTTAGATGCTTCAGCTGCACA
TATTGCTAACCTCTTGTCAACTGAACCAACAGATGTCAAAGTTGGGATAGGAGGTTTCAGCATGGGTGCAGCAATAGCTC
TTTATTCCACGACGTGCTACGCTCTTGGACGTTACGGAACCGGACATCCTTATACTATAAACCTACGAGCTACTGTAGGA
CTTAGTGGTTGGCTTCCTGGTTGGAGGAGCTTAAGGAGCAAAATAGAAAGCTCTAATGAGGCCGCAAGGCGTGCTGCAAC
AATACCAGTTATACTTACTCATGGAACTTCGGATGATGTAGTTCCTTACAGATTTGGAGAAAAATCAGCGTATTCACTTG
CTATGGCTGGATTCCGACAAGTTGTGTTCAAACCATATGAAGGGCTTGGTCATTACACGGTTCCTAAGGAAATGGAGGAG
GTGGTTCACTGGCTCGCTTCAAGGCTTGGTCTTGAGGGATGGCGTTAA