Details for Kale Locus Bo5g126780

Position : C5 ( 5`- 39123624 .. 39124841 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126780

Protein [Map View]
MAAVLSSRFLKGIANLRCTRLASASGYQHGMMRSYSTRVPSESDTHDDFKPTQKVPSGSTASLKDIVENDVKENPVMIYM
KGVPEAPQCGFSSLAVRVLQQYNVPIGARNILEDQDLKNAVKSFSHWPTFPQIFIKGEFIGGSDIILNMHKEGQLEEKLK
DVSGNQSSQ*

DNA
ATGGCGGCTGTATTGTCGAGCAGGTTTCTCAAAGGAATCGCTAACCTTCGTTGTACCAGATTGGCATCTGCATCGGGCTA
CCAACATGGGATGATGAGATCCTACTCTACTAGAGTGCCCAGCGAATCAGACACGCATGATGATTTCAAGCCTACACAGA
AAGTCCCTTCCGGTTCTACTGCCTCGCTAAAGGATATCGTTGAGAATGATGTGAAGGAGAATCCTGTTATGATCTACATG
AAAGGAGTTCCGGAAGCTCCTCAGTGTGGGTTTAGCTCACTAGCCGTAAGAGTTCTGCAACAATATAATGTTCCTATCGG
TGCTAGGAACATTCTTGAAGATCAAGACTTGAAAAACGCTGTGAAATCCTTCAGCCATTGGCCTACGTTTCCTCAGATCT
TCATCAAGGGAGAGTTTATTGGAGGCTCAGACATCATCCTTAACATGCACAAGGAAGGTCAACTTGAGGAAAAGCTTAAA
GACGTCTCTGGAAACCAAAGCTCTCAATAA