Details for Kale Locus Bo5g126770

Position : C5 ( 5`- 39121796 .. 39122582 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126770

Protein [Map View]
MASNQQSYKAGETRGKTQEKTGQAMGAMRDKAEEGKDKTSQTAQTAQTAQQKAQETAQAAKEKTSQASQTTQQKAQETAQ
ATKDKTSQAAQTTQQKAHETTQAAKDKTSQAAQTAQEKARETKDKTGSYMSETGEAIKQKAQNAAQYTKETAQEAAQYTK
ETAEAGRDKTGGFLSQTGEQVKQMAMGAADAVKHTFGMATDEEDREHYPGTTTTTTGATRTTDPTHHTYQRK*

DNA
ATGGCGTCCAACCAACAAAGCTACAAAGCTGGTGAAACAAGAGGCAAGACTCAGGAGAAGACGGGACAAGCTATGGGAGC
GATGAGGGACAAGGCTGAGGAAGGCAAGGACAAGACTTCCCAAACGGCCCAAACGGCCCAAACGGCCCAACAAAAGGCTC
AGGAGACGGCCCAGGCAGCGAAAGAGAAGACATCTCAAGCTTCCCAAACGACCCAGCAAAAGGCTCAGGAGACGGCACAG
GCAACGAAAGACAAGACCTCTCAAGCTGCCCAAACGACCCAGCAAAAGGCTCATGAGACGACCCAAGCAGCAAAAGACAA
GACATCTCAAGCTGCCCAGACGGCCCAAGAAAAAGCCCGGGAGACGAAGGACAAGACCGGAAGTTACATGTCCGAGACAG
GAGAAGCCATAAAGCAGAAGGCTCAAAACGCTGCTCAATACACAAAGGAGACGGCTCAAGAAGCGGCTCAGTACACGAAA
GAGACGGCTGAAGCCGGTAGAGACAAGACCGGTGGGTTCTTGAGCCAGACAGGTGAGCAAGTGAAGCAGATGGCAATGGG
TGCAGCTGATGCGGTGAAGCACACTTTTGGAATGGCTACGGATGAAGAAGACAGGGAGCATTATCCAGGCACCACTACGA
CCACTACTGGTGCTACTCGGACCACTGATCCGACTCATCATACTTATCAGAGGAAGTGA