Details for Kale Locus Bo5g126760

Position : C5 ( 5`- 39111363 .. 39113310 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126760

Protein [Map View]
MASCSLGVPKIKISAVDLSRVRSGSLQIPCNQRVLIGQRPVKYLSLRATLGSVKAPQASTVTAAESAATVEVEDAEMTKP
SPLNAQLVPKPSEVEALVTEICDSSSIAEFELKLGGFRLYVARNLADNNSSPPQPQPIPAAVAASATTEGVDSNGSASST
SLAITKPTSSAADQGLVILQSPKVGFFRRSKTIKGKRTPSSCKEKDQVKEGQVLCYIEQLGGQFPIESDVTGEVVKILRE
DGEPVGYNDALISILPSFPGIKKLQ*

DNA
ATGGCTTCCTGTAGCCTAGGAGTTCCTAAGATTAAAATCTCAGCAGTAGACCTCAGTAGAGTAAGATCTGGAAGCTTACA
GATACCATGCAATCAAAGAGTGTTGATTGGTCAAAGGCCGGTTAAGTACTTGAGTCTCAGGGCAACTCTTGGTTCTGTGA
AAGCTCCCCAAGCGTCTACTGTCACAGCTGCTGAATCTGCAGCTACTGTTGAAGTAGAAGATGCTGAAATGACCAAGCCA
TCTCCATTGAACGCTCAGCTTGTTCCCAAGCCCTCTGAGGTGGAAGCTCTTGTAACTGAAATATGCGACTCCTCATCAAT
TGCAGAGTTTGAATTGAAACTGGGGGGTTTCCGCCTATATGTAGCAAGGAACTTAGCTGACAACAACAGTAGTCCACCAC
AACCTCAGCCCATTCCTGCTGCCGTTGCTGCAAGTGCAACCACGGAGGGTGTTGATTCGAATGGATCAGCTTCCTCTACT
TCACTGGCTATCACAAAACCAACATCCTCAGCTGCTGATCAGGGTTTGGTGATTCTCCAATCTCCAAAAGTAGGGTTCTT
CAGGAGATCCAAAACCATAAAGGGTAAACGCACTCCTTCGTCATGTAAAGAGAAAGACCAAGTGAAAGAAGGTCAAGTTC
TGTGCTATATTGAACAACTCGGTGGCCAGTTTCCAATCGAGTCTGATGTTACCGGCGAGGTTGTCAAAATACTCAGAGAG
GATGGAGAGCCTGTAGGATACAATGATGCTCTCATATCAATCCTTCCTTCCTTTCCTGGGATCAAGAAGCTTCAGTAG